(data stored in ACNUC7421 zone)

EMBL: BA000030.PE637

BA000030.PE637       Location/Qualifiers
FT   CDS_pept        complement(785031..785402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_632"
FT                   /old_locus_tag="SAV_632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_632"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68341"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q89"
FT                   /protein_id="BAC68341.1"
FT                   /translation="MRCVPSRRSFKVTDRTTSLSDSAEQGPQIPRLHRVDQGAARLPAA
FT                   APAYLPAQDAYFGALDRAGLTTVASTVKTGLNTSSSIGVRFTTQWASQSNDLITAYWPD
FT                   ILDGTKPLSDLQTMTDKSN"
     gtgcgatgcg tcccgtcgcg caggtccttc aaggtcaccg accgcacgac atcgttgtcg        60
     gactccgcgg agcaaggtcc tcaaatacct cgactccacc gtgtggacca aggtgctgcc       120
     cgactccccg ctgcggcccc ggcctacctc ccggcgcagg acgcctactt cggtgccctc       180
     gacagggccg gcctgacgac cgtcgcgtcc accgtcaaga cgggactgaa cacgtcgtcc       240
     agcatcggcg tgcgcttcac cacccagtgg gccagccagt cgaacgacct gatcaccgcc       300
     tactggccgg atatcctcga cggcacaaag ccgctctccg acctccagac catgaccgac       360
     aagagcaact ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page