(data stored in ACNUC7421 zone)

EMBL: BA000030.PE638

BA000030.PE638       Location/Qualifiers
FT   CDS_pept        785356..785871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_631"
FT                   /old_locus_tag="SAV_631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_631"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68342"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q88"
FT                   /protein_id="BAC68342.1"
FT                   /translation="MRSVTLKDLRDGTHRTLAARYVLDATETGELLHLAGVEHANGAES
FT                   RATACPLADLALGRIVFPTAPLPPGMTDPRAAVDGDAGTAWSPGPDGRMVVDLDAEQHI
FT                   TEIRTQWRGGHAPASQVEFSRDGRTYGGAAQLSARGVLRTDSTPRDVALRVITSSAGPT
FT                   SLIALTIA"
     gtgcggtcgg tgaccttgaa ggacctgcgc gacgggacgc atcgcaccct cgccgcgcgt        60
     tacgtcctgg acgccaccga gacgggcgaa ctcctccacc tcgcgggcgt cgagcacgcg       120
     aacggggccg agtcgcgcgc cacggcgtgc ccgctcgccg acctggcact cggccgcatc       180
     gtcttcccga ccgcaccgtt gccgcccggt atgacggacc cgagggccgc ggtcgacggc       240
     gacgccggca ccgcatggtc ccccggtcct gacggtcgca tggtcgtcga cctggacgcc       300
     gaacagcaca tcaccgagat ccggacccag tggcgaggag gccatgcccc ggcatcccaa       360
     gtcgagttca gccgggacgg ccgtacgtac ggtggcgctg cgcagctgtc ggcgcgtggc       420
     gtcctgcgca ccgacagcac cccccgcgac gtggcactac gggtcatcac ttcgtccgcg       480
     ggacccacct cactcatcgc cctcactatt gcgtag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page