(data stored in ACNUC7421 zone)

EMBL: BA000030.PE643

BA000030.PE643       Location/Qualifiers
FT   CDS_pept        complement(792236..792676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_637"
FT                   /old_locus_tag="SAV_637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_637"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68347"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q83"
FT                   /protein_id="BAC68347.1"
FT                   /translation="MTATFGPGGHVFLSWPLRSGLFRGGTGSASTRWHRLYAQWDSALL
FT                   VERTGPMDVVFSSHVIEWRGPSPFYFVPVPEEQSADIREVASMATYGWGVVPVEARIGE
FT                   IAFATSLFPKDGEYLLPIKQAVRKPQGLSTGDEVTVEMTVRL"
     gtgacggcga ccttcggccc tggtggtcat gtgttcttga gctggcccct gcggtccggc        60
     ctctttcgcg gcgggactgg atctgcgtcc acgaggtggc accgcttgta cgctcagtgg       120
     gattcagcac tcctcgtgga acggaccggc cctatggacg tcgtcttctc cagccatgtg       180
     atcgaatggc gcgggccttc cccgttctac ttcgtccctg taccggagga gcagtctgcc       240
     gacatacggg aggtagcgtc gatggccacg tacgggtggg gcgttgttcc tgttgaggcc       300
     cggatcggtg agatcgcctt tgcgacgtca ctcttcccga aggacggcga gtacctgctc       360
     ccgatcaaac aggccgtgcg caaaccacag ggtctttcga caggggacga ggtcaccgta       420
     gaaatgaccg ttcgcctctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page