(data stored in ACNUC7421 zone)

EMBL: BA000030.PE649

BA000030.PE649       Location/Qualifiers
FT   CDS_pept        complement(801354..801581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_643"
FT                   /old_locus_tag="SAV_643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_643"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68353"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q78"
FT                   /protein_id="BAC68353.1"
FT                   /translation="MSSALLHQAVLQARGPADTRVQDAPEAAAAIVNLCGPAPGLAYRR
FT                   HPVRRSGLSTESDAVLADLDDFTVEENLQG"
     gtgtccagcg ccctgctgca ccaggccgtc ctacaggccc gcggacccgc cgacacccgt        60
     gttcaggatg cccccgaagc agccgcagcc atcgtcaacc tgtgcgggcc tgcccctggc       120
     cttgcgtatc gccgccaccc tgttcgccgc tccggcctgt cgacagagag cgacgctgtt       180
     cttgccgacc tggatgactt caccgtcgag gagaacctcc agggctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page