(data stored in ACNUC7421 zone)

EMBL: BA000030.PE65

BA000030.PE65        Location/Qualifiers
FT   CDS_pept        74098..74520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_65"
FT                   /old_locus_tag="SAV_65"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_65"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67774"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RS8"
FT                   /protein_id="BAC67774.1"
FT                   /translation="MTDDAYLFLLDDPAVPLGVPPSVAGELSCMDTPAVRAWLDAQGVT
FT                   TTSPALRILPPEQTAAIPEQAERLPVPLSEAELSRLRHHNAPEAVARLEEELLAYRDCT
FT                   DGRDTLLRRALAAGIPLARIVELTGEEPAAVAASSG"
     atgaccgacg acgcctatct cttcctgctg gacgacccgg ccgtgccgct cggcgtgccg        60
     ccgagcgtgg ccggtgagct gtcatgcatg gacacccctg ccgtgcgggc gtggctcgac       120
     gcgcagggtg tcacgacgac gtccccggcg ctgcggatac tgccgccgga acagaccgcg       180
     gcgattccgg agcaggcgga acggctgccg gttccgctga gcgaggcgga actgagccgc       240
     ttgcgtcacc acaacgcccc tgaggccgtc gcccgcctcg aggaggagct cctggcctac       300
     cgcgactgca cggacggccg cgacaccctg ctcaggcggg cccttgcggc cggaattccc       360
     ctggcgcgca tcgtggaact gacgggtgag gaaccggcgg ccgtggccgc ctcctccggg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page