(data stored in ACNUC7421 zone)

EMBL: BA000030.PE650

BA000030.PE650       Location/Qualifiers
FT   CDS_pept        802775..803185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_644"
FT                   /old_locus_tag="SAV_644"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_644"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68354"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q77"
FT                   /protein_id="BAC68354.1"
FT                   /translation="MLRHRVVVRHLTRATVTSCCAAALALTQTVQAHAASRTVNFNYQH
FT                   IWKTPEFETGIRGRIHFTVKKCDHPNGDMTVLLRRTDGFNYVVGSRNIKCRAGHTANWD
FT                   DDPAGTYEFELGKLDDYKFFKGTATYSFNAAR"
     atgcttcgac accgtgtcgt ggtgcggcac ctgacccgcg ccaccgtgac ctcgtgctgc        60
     gccgctgctc tcgccctcac acagacggtg caggcccacg cggcgagccg cacggtcaac       120
     ttcaactacc aacacatctg gaagacaccc gagttcgaaa cgggtatccg cggccgcatc       180
     cacttcaccg tcaagaagtg cgaccacccc aacggggaca tgaccgtgct gctgaggcgc       240
     actgatggct tcaactacgt cgtgggcagc cggaacatca agtgccgcgc tggccacacg       300
     gccaactggg acgacgatcc ggcggggacc tacgagttcg agctcggcaa gctcgacgac       360
     tacaagttct tcaagggcac cgccacctac tcgttcaacg ccgccaggta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page