(data stored in ACNUC7421 zone)

EMBL: BA000030.PE667

BA000030.PE667       Location/Qualifiers
FT   CDS_pept        complement(818939..819619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_661"
FT                   /old_locus_tag="SAV_661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_661"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68371"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q60"
FT                   /protein_id="BAC68371.1"
FT                   /translation="MLLPRQTVQCALRDQSACGLASHGATFWPTTKQHESTTSRASGST
FT                   GQLRHNVTTAPGKSRCCLVGATAGLRASPPSGCRSRCRTSAHHFVDSYADMHDLAEDLP
FT                   VPDGVPEAAATVLHTARELLRHSYVCYEFSAVAVMHFLIAVEIVLRDRIPDAGKKPLRK
FT                   LIEQGAGAGVLTARQAEYLDYGRKIRNGMAHGQTTHTAMPPAVAVLMVTTSFAIVTEPC
FT                   APAL"
     atgctccttc cgcggcagac cgttcaatgt gcgctgcgtg accaaagcgc ctgtggactg        60
     gccagccacg gcgcgacgtt ctggccaacg accaagcaac acgagtccac gaccagccgc       120
     gcttcgggaa gcactggcca actgcggcac aacgtcacca cggccccggg gaagagccgc       180
     tgttgcctgg tgggcgcaac tgccggactg cgcgcatcac cgcccagcgg ctgccgttcc       240
     cggtgccgga cgagcgccca ccacttcgtc gacagttacg ccgacatgca cgacctcgct       300
     gaggacctgc ccgtgcccga cggcgtaccc gaggccgcgg cgacggtcct gcacacggcc       360
     cgcgagctgc tgcgccactc gtacgtctgc tacgagttct ccgccgtggc ggtcatgcac       420
     ttcctgatcg cggtggagat cgtgctgcgc gaccgcatcc cggacgccgg caagaagccg       480
     ctgcggaagc tcatcgagca gggcgccggg gcgggggtcc tgacggcccg gcaggcggag       540
     tacctcgact acggccgcaa gatccgcaac ggcatggcac acggccagac cacccacacg       600
     gcgatgcctc cggccgtggc ggtcctgatg gtgaccacct cgttcgcgat cgtcaccgag       660
     ccgtgcgccc ctgccctgtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page