(data stored in ACNUC7421 zone)

EMBL: BA000030.PE668

BA000030.PE668       Location/Qualifiers
FT   CDS_pept        complement(819960..820334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_662"
FT                   /old_locus_tag="SAV_662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_662"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68372"
FT                   /db_xref="GOA:Q82Q59"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q59"
FT                   /protein_id="BAC68372.1"
FT                   /translation="MATQVTATANAQRSASFLQIAIALQTLTIFLQAVSAGLLLTSSYG
FT                   ETLHSVGARVMYGASMLYVLAAVLAWKPGGGSPRPVWHASGFLVLASVQVLLGIAHVPS
FT                   VHLPLGVLMFGLSVLALARR"
     atggccactc aggtgacggc gacagcgaac gcacagcgca gcgcctcgtt cctgcagatc        60
     gcgatcgccc tgcagaccct gaccatcttc cttcaggcgg tctccgccgg actgctgctg       120
     acctcgtcct acggagagac gctgcacagt gtcggagccc gtgtgatgta cggggcgtcg       180
     atgctgtatg tgctcgccgc ggtgctggcg tggaagccgg gcggcggctc gccccggcct       240
     gtctggcacg cctccggttt cctcgtactt gcctcggtcc aggtcctgct cggcatcgcg       300
     cacgtcccgt cggtccatct ccccctggga gtcctgatgt tcggtctgag tgtgctggcg       360
     ctggcccggc gctaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page