(data stored in ACNUC7421 zone)

EMBL: BA000030.PE678

BA000030.PE678       Location/Qualifiers
FT   CDS_pept        830486..830860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_672"
FT                   /old_locus_tag="SAV_672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_672"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68382"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q49"
FT                   /protein_id="BAC68382.1"
FT                   /translation="MIIRHIPGSPESRCRAGIASLLVWVMQRRVVLADRAERLRKELAE
FT                   IDAEVARLEAAEVVIGQFIEAEGNGQADDPAVVQELERVTTTPGAGGMLLVPHREPDMD
FT                   ESALRDQQHPGIGPRQPCDL"
     gtgatcatcc gacacattcc cggttcgccg gaatcgcgat gccgggccgg gattgcctca        60
     ctgctggtct gggtgatgca gcggagggtc gtgctggccg atcgcgccga acggctgcgc       120
     aaggagctcg ccgagatcga tgccgaggtg gcccggctgg aggcagcgga ggtggtgatc       180
     gggcagttca tcgaggccga ggggaacggg caggccgacg acccggctgt ggtgcaggag       240
     ttggagcgag tgacgacgac tcctggtgca ggcgggatgc tgctggtccc acatcgcgag       300
     ccggacatgg acgagagcgc gctgcgggac cagcagcatc ccggcatcgg cccccgccag       360
     ccctgtgacc tgtag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page