(data stored in ACNUC7421 zone)

EMBL: BA000030.PE680

BA000030.PE680       Location/Qualifiers
FT   CDS_pept        831803..832024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_674"
FT                   /old_locus_tag="SAV_674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_674"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68384"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q47"
FT                   /protein_id="BAC68384.1"
FT                   /translation="MPDDHPLPITPTTGTSISAPVHASPMTSEFRLNNAQWSAGIVEGH
FT                   VNRVKALKRAMYRRAPFELLRIRILTQP"
     gtgccggatg atcacccgct accgatcaca cccacgaccg gcacgagcat ctcagccccc        60
     gtccacgcca gccccatgac cagcgaattc aggttgaaca acgctcaatg gagtgcgggg       120
     atcgtcgagg ggcatgtgaa ccgggtgaaa gccctcaaga gggctatgta tcgcagggcg       180
     ccctttgaac tcctccgcat ccgcatcctc acccagccat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page