(data stored in ACNUC7421 zone)

EMBL: BA000030.PE691

BA000030.PE691       Location/Qualifiers
FT   CDS_pept        complement(839801..840232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_685"
FT                   /old_locus_tag="SAV_685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_685"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68395"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q36"
FT                   /protein_id="BAC68395.1"
FT                   /translation="MDSPVHGAESASATAPGAGERTAARGRRCGPLRTALGPPFQDRVM
FT                   LVVTYWRTNLTMRQLAPLFGGWKSAADQVIDQLGPHLALQPRRRFRNDAVLIVDGTLVP
FT                   TRDRTVAKQSKNYRHSTNHQVVIDADSRLVVVIGRPLPR"
     gtggatagcc cagttcacgg ggccgagtcc gcgtccgcga cagctccggg ggctggtgag        60
     cgcactgcgg cgcgagggcg ccgatgtggt ccgctgcgga cggccctggg gccgccgttc       120
     caggaccggg tcatgctggt cgtaacgtac tggcgtacca acttgacgat gcgccagttg       180
     gcacccctct tcggtggctg gaagtccgct gccgaccagg tcatcgacca gctcggtccg       240
     catctcgctc tccaaccccg cagacgtttc cggaatgacg ctgtgctgat cgtggacggc       300
     actttggtgc ccactcgcga ccgcacggtg gccaagcagt ccaagaacta tcggcactcc       360
     accaaccatc aggtggtcat tgacgccgac agtcgcctgg tcgtcgtgat cggccgacca       420
     ctaccccggt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page