(data stored in ACNUC7421 zone)

EMBL: BA000030.PE694

BA000030.PE694       Location/Qualifiers
FT   CDS_pept        842362..842616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_688"
FT                   /old_locus_tag="SAV_688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_688"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68398"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q33"
FT                   /protein_id="BAC68398.1"
FT                   /translation="MRAPEGTASLVRPALPVHKGVIMSATDPTRGSAQQMRQKVQEMEE
FT                   AAQRASDPQERQKLQDKARKLREQSERQGGQSEGIDPTI"
     atgcgcgcac ccgaggggac tgcttcgctg gtcaggcccg ctctccccgt tcacaaagga        60
     gtgatcatga gcgcaacaga ccctacccgt ggttctgccc agcaaatgcg gcagaaggtc       120
     caggagatgg aagaggccgc ccagcgcgcc tccgaccctc aggagcgcca gaagctgcag       180
     gacaaggccc gcaagctgcg cgagcagagc gagcggcagg gcggccagtc tgagggcatc       240
     gaccccacga tctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page