(data stored in ACNUC7421 zone)

EMBL: BA000030.PE699

BA000030.PE699       Location/Qualifiers
FT   CDS_pept        complement(846848..847663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_693"
FT                   /old_locus_tag="SAV_693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_693"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68403"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q28"
FT                   /protein_id="BAC68403.1"
FT                   /translation="MADVPKIALAAAVLGGYVVGRTKKGRVAFAMATYLAGRRFGLEPQ
FT                   QLLAEGVKRLRELPQFADLNEQLRGEVLEAGRKAMTTAADRKLADLADSLHQRTERMGS
FT                   KGKEEPQDDEEPEEGDEEEEVPEGEEPEEGEGEEAEDEYEEDEEEEPEEEPGEDEEEPE
FT                   GEQEPEEEEEPEEEEEPEEEEEPERPASRRRRAARKPDDDSDGGSRRGRGGARRPERAA
FT                   ARKAPAKKSAPAKKTSAARKSSASPKKSPVKKSAAKKTAAKKASSRRRR"
     atggctgatg tacccaagat cgctcttgcc gccgcagttc tcggcgggta tgtcgtgggc        60
     cggacgaaga agggacgagt cgcgttcgcg atggcgactt acctggccgg ccgccggttc       120
     gggctggaac cacagcaact gttggcggag ggcgtcaaga ggctgcgtga gctcccccag       180
     ttcgccgacc tcaacgagca gctccgcggt gaggtactcg aggccgggcg gaaggcgatg       240
     accacggcgg ccgaccgcaa actcgccgat ctggccgact ccctgcacca gcgcaccgag       300
     cgcatgggca gcaagggcaa ggaggagccg caggacgacg aagagccgga ggagggagac       360
     gaggaagagg aagtgccgga gggcgaagag cccgaagaag gagaggggga ggaagccgag       420
     gacgagtacg aagaggacga ggaagaagaa ccggaggagg agccggggga ggacgaggag       480
     gagcctgaag gcgaacagga gccggaggaa gaagaggagc cggaggaaga agaggagccg       540
     gaggaagaag aggagccgga aaggcccgct tcccggcgtc gccgcgcagc tcggaagccg       600
     gacgacgaca gcgatggggg ttctcggcgc ggtcgaggcg gcgcgcgtcg tcctgagagg       660
     gccgctgccc gcaaggcacc tgccaagaag tcggctcccg cgaagaagac gtcagcggcg       720
     aggaagtcct cggcttcgcc gaagaagtcc cctgtgaaga agtccgcagc caagaagaca       780
     gcggcaaaga aggcatcctc acggcggcgg aggtag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page