(data stored in ACNUC7421 zone)

EMBL: BA000030.PE700

BA000030.PE700       Location/Qualifiers
FT   CDS_pept        complement(848379..849155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_694"
FT                   /old_locus_tag="SAV_694"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_694"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68404"
FT                   /db_xref="GOA:Q82Q27"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q27"
FT                   /protein_id="BAC68404.1"
FT                   /translation="MSSFSLAVRDSSTMLRRNLLHARRYPSLTLNLLLTPVMLLLLFVY
FT                   IFGDTMSGGAGRSAYIAYIVPGILLMTIGSTTIGTAVSVSTDMNEGIIARFRTMAIHRS
FT                   SVLFGHVAGSVLQAIMSVVLVGAVGVAMGFRSTDATVLEWLAAFGLLALFALAFTWIAV
FT                   GMGLGSPNAEAASNNAMPLILLPLISSAFVPLDSMPGWFQPIAEYQPFTPAIETLRGLL
FT                   LGTEIGNNWWIALAWCLGLTVLGHRWSKAQFNRDPK"
     atgagctcct tctccctcgc ggtacgcgac tcctccacga tgctgcgccg caacctcctg        60
     cacgcccgcc gctatccgtc gctcaccctg aacctgctgc tcactccggt catgctgttg       120
     ctgctgttcg tgtacatctt cggcgacacc atgagcggcg gcgcgggccg ctccgcctac       180
     atcgcctaca tcgtccccgg catcctgttg atgaccatcg gctccaccac gatcggcacc       240
     gccgtctcgg tctccaccga catgaacgaa ggcatcatcg cccgcttccg caccatggcc       300
     atccaccgca gctccgtgct gttcgggcac gtcgccggca gcgtgctgca agcgatcatg       360
     agcgtggtcc tcgtcggggc cgtcggcgtc gccatgggct tccgctccac ggatgccacc       420
     gtcctggaat ggctggcagc attcgggttg ctcgcgctgt tcgccctggc gttcacctgg       480
     atcgcagtcg gcatgggcct gggcagcccc aacgccgaag ccgccagcaa caacgccatg       540
     ccgctgatcc tgctgcccct catctccagc gccttcgtcc cgctggactc catgcccggc       600
     tggttccagc cgatcgccga gtaccagccc ttcacccccg ccatcgagac cctgcgcgga       660
     ctcctgctgg gcaccgagat cggcaacaac tggtggatcg ccctcgcctg gtgcctgggc       720
     ctgaccgtcc tcggccaccg ctggtcgaag gcgcagttca accgcgaccc caaatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page