(data stored in ACNUC7421 zone)

EMBL: BA000030.PE707

BA000030.PE707       Location/Qualifiers
FT   CDS_pept        855582..856205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_701"
FT                   /old_locus_tag="SAV_701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_701"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68411"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q20"
FT                   /protein_id="BAC68411.1"
FT                   /translation="MSMRTTFEDRLLGELKREIELREAGVASTGTAEFKTGEGRAKAAV
FT                   GRLFAPLTPRRMAAVAAACTAAWLAAVIMPGSPAGSNAWAVDPVGDGSVKLTVQDQNIS
FT                   VAAQRELARKVRPWGVHVTVDVLAPGYVCERSKVASPLVASDEHGNRVPVIPFKSSWDV
FT                   TLRRGNVLTFENTKGSSQPRAVEFYETRSEAEPCVPMKVVLPDD"
     atgagcatga ggacgacgtt cgaggaccgg ctactgggtg agctgaagcg ggagatcgag        60
     ctgcgcgagg ccggagtagc cagcaccgga acggctgagt tcaagacggg cgagggcagg       120
     gcgaaggctg ccgtgggtcg tctgttcgct ccgctcactc cgcgccggat ggctgccgtt       180
     gcggcggcct gtacagcggc ctggctcgcc gcggtgatca tgcccggttc gccggccggc       240
     tcgaacgcgt gggcggtgga tccggtcgga gacggcagcg tcaagctcac cgtccaggac       300
     cagaacatca gtgtcgcggc ccagcgcgag ctcgcgagga aggtgcgccc atggggcgtt       360
     cacgtgaccg ttgacgtgct cgctcccggc tacgtctgtg agcgcagcaa agtcgcctct       420
     ccgctcgtgg cgagtgatga acacggcaac cgtgtacccg tcattccttt taagtccagc       480
     tgggacgtca cactgcgccg gggcaacgtg ctgaccttcg agaacaccaa aggcagctcc       540
     cagcctcgcg cggtcgagtt ctacgagacc aggagcgagg ccgagccctg cgttccgatg       600
     aaggttgtcc tgccggacga ctag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page