(data stored in ACNUC7421 zone)

EMBL: BA000030.PE716

BA000030.PE716       Location/Qualifiers
FT   CDS_pept        complement(864970..865173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_710"
FT                   /old_locus_tag="SAV_710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_710"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68420"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q11"
FT                   /protein_id="BAC68420.1"
FT                   /translation="MRDMPVLNTAGEEDSQFPVHVVRKMTDAIEGSTLRLLQHTAHLAA
FT                   RTNPEGVNAEIDAFLAALPAAA"
     atgagggaca tgcccgtcct gaacaccgcc ggcgaggagg acagccagtt ccccgtgcac        60
     gtggtgcgga agatgaccga cgccatcgag ggcagtacct tgcggctgct ccagcacacc       120
     gcccacctcg ccgcccgcac gaaccccgaa ggtgtcaacg ccgagatcga cgccttcctt       180
     gccgccctgc ctgccgcagc ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page