(data stored in ACNUC7421 zone)

EMBL: BA000030.PE84

BA000030.PE84        Location/Qualifiers
FT   CDS_pept        complement(92939..94183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_84"
FT                   /old_locus_tag="SAV_84"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_84"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67793"
FT                   /db_xref="GOA:Q82RQ9"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ9"
FT                   /protein_id="BAC67793.1"
FT                   /translation="MATGIKDTAHAVEAAAVMRLLPARPRLLALGEPTHGEDTLLGLRN
FT                   ELFRQLVEQEGYRTIAIESDCLTGLAVDDYVTSGTGTLDEAMEHGFSHGWGTFAANREL
FT                   VRWMRAYNVRAANDGRPACERLRFAGFDGPLEITHAASPRQALTALHSYLATRVDTNLL
FT                   PCTATTLDHLLGTDDRWTHPAAMTDPAQSAGQSAEAGRLRLLADDLVALLDAQTPHLTT
FT                   ATSRDDWDRARLYGRTATGLLRYHYWMADTSPARMTRLVGLRDQMMAHNLLALAARGPA
FT                   LIHAHNSHLQRAKSTMRMGGIPLEWWSAGALVSARLGEEYAFVATALGTIRHQKVDTPP
FT                   PDTVEGLLYALPQDRCVIDAPRLATALGDTRPAPRVSPWFGYAPLDPAHLADSDGIVFV
FT                   KDVVQSRPRLFSKTG"
     atggctactg gcatcaagga caccgcccat gctgttgagg ccgccgccgt catgaggctg        60
     ctcccggccc ggccccggct gctcgccctg ggcgagccca cccacggcga ggacactctc       120
     ctcggcctgc gcaacgaact cttccggcag ctcgtcgagc aggagggcta ccggacgatc       180
     gcgatcgaga gcgactgcct gacgggcctg gccgtggacg actacgtcac ctcgggcacc       240
     ggcactctcg acgaggccat ggaacacgga ttcagccacg gctggggcac ctttgcggcc       300
     aaccgcgaac tcgtgcgctg gatgcgcgcc tacaatgtcc gtgccgccaa cgacggccgg       360
     cccgcctgcg agcggctccg cttcgccggc ttcgacggcc cgctggagat cacccacgcc       420
     gcgagccccc ggcaggccct caccgcactc cacagctacc tcgcgacccg ggtggacaca       480
     aacctgctcc cctgcaccgc aaccacactc gaccacctgc tcggcaccga cgaccggtgg       540
     acccatcccg ccgcgatgac ggacccggcc cagtccgcgg ggcagtcggc cgaggccggc       600
     cggctgcggc tgctcgccga cgatctggtg gcgctgctcg acgcacagac gccgcacctg       660
     accacggcga cctcgcggga cgactgggac cgggcacgcc tgtacgggcg caccgcgacc       720
     ggcctgctgc gctaccacta ctggatggcc gacacctcac cggcccgcat gacccggctg       780
     gtgggcctgc gggaccagat gatggcccac aacctcctcg ccctcgccgc ccggggcccg       840
     gcactcatcc acgcccacaa ctcccatctc cagcgggcca agagcacgat gcgcatgggc       900
     gggataccgc tggagtggtg gagcgccggt gcgctggtga gcgcccggct cggcgaggag       960
     tatgccttcg tggccaccgc cctcggcacg atccgccacc agaaagtgga caccccgccg      1020
     ccggacaccg tcgaaggact cctgtacgcg ctcccgcagg accgctgcgt catcgacgcc      1080
     ccgcggctgg ccaccgccct cggcgacacg cggcccgcgc cccgcgtatc cccctggttc      1140
     ggctacgccc cgctcgaccc ggcccacctg gcggacagcg acggcatcgt gttcgtcaag      1200
     gacgtcgtgc agagccggcc ccggctgttc agcaaaaccg gctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page