(data stored in ACNUC7421 zone)

EMBL: BA000030.PE88

BA000030.PE88        Location/Qualifiers
FT   CDS_pept        complement(99274..100050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_88"
FT                   /old_locus_tag="SAV_88"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_88"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67797"
FT                   /db_xref="GOA:Q82RQ5"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ5"
FT                   /protein_id="BAC67797.1"
FT                   /translation="MTTQPLRTERSGPQTASLVTDLPFKPQLVKAVFRDVTSLHVSRPA
FT                   AWAAASVTRTVLTEIIDGARSAAAEEARKRLIPKDLISAIDRNVEVEVGSAWYLHSPTF
FT                   HGLMGEVRNADGALVSLRERRGARTPSGVAGAHRFEAGVRRLLASRGVRAVPAMVRDLD
FT                   GIVSVFLTALARDAAKVVREGGVKRFGTVSLVVPGEPAPAPLLKDPLLALSTRRGDGRT
FT                   VGGDDVLAAVTMQLFGDLRQRAITEAAEMTRNTSAN"
     atgaccacac aacccctacg caccgagcgc agcggtccgc agaccgcttc cctcgtgacc        60
     gacctgccgt tcaagcctca gctcgtcaaa gcggtgttca gggacgtgac ctcgttgcac       120
     gtctcccggc cggccgcgtg ggccgccgcg tcggtgacgc ggaccgtgct gacggagatc       180
     atcgacggcg cgagaagcgc ggcggccgag gaggccagga agaggctgat tcccaaggac       240
     ctcatctcgg cgatcgaccg gaacgtcgag gtggaggtgg gatcggcgtg gtacctgcac       300
     agcccgacct tccacggcct gatgggcgag gtgcgcaacg ccgatggtgc gctcgtgtct       360
     cttcgtgagc gccgcggggc gcgtacaccg agtggtgtgg ctggcgccca ccggttcgag       420
     gccggggtga gaaggctgct ggcaagccgg ggggtgaggg cggtcccggc gatggtccgc       480
     gacctggacg gaatcgtgag cgtgttcctg acggccctgg cccgggacgc ggccaaggtc       540
     gtccgcgagg gcggggtcaa gcggttcggg acggtcagtc tggtggtgcc gggcgagcca       600
     gccccggccc cgctgctcaa ggaccccctc ctcgccctgt ccacccgccg cggggacggg       660
     cggactgttg gcggggacga cgtcctggcc gccgtcacga tgcagctgtt cggcgatctc       720
     agacaacgcg ccatcaccga ggcagccgag atgacacgga acacgtcggc caactga          777
//

If you have problems or comments...

PBIL Back to PBIL home page