(data stored in ACNUC7421 zone)

EMBL: BA000030.PE89

BA000030.PE89        Location/Qualifiers
FT   CDS_pept        complement(100279..100866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_89"
FT                   /old_locus_tag="SAV_89"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_89"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67798"
FT                   /db_xref="InterPro:IPR005506"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ4"
FT                   /protein_id="BAC67798.1"
FT                   /translation="MRLHRVAPGIAAGILAPALLLATPSFAATAAPTAVTVPAVSSSAN
FT                   EPDADDLRVAIVRILADPDSGQRVTREANALLDANDPEAMRAWLETGYRIAQAEDDRVA
FT                   ITRLLADPDSGRRVIAEVNALLDANDSDAIRAWLETGYRIAQAEDDRVAIARILADPSI
FT                   SPALRAAANAALDDNTPEALRHFLEVGRYQVA"
     ttgcgactgc atcgcgtagc gcccggcatc gccgcgggca tcctcgcccc ggccctcctg        60
     ctcgccaccc cgtccttcgc cgccacggcg gcaccgaccg cggtgacggt gcccgcggtg       120
     tcctcgtccg ccaacgagcc ggacgccgac gacctgaggg tggccatagt ccggatcctc       180
     gccgacccgg acagcggcca gcgtgtgaca cgagaagcca acgccctcct ggacgccaac       240
     gaccccgagg ccatgcgcgc ctggctggag accggctacc gcatcgccca ggccgaggac       300
     gaccgcgtcg ccatcacgcg cctgctcgcc gaccccgaca gcggccggcg cgtcatcgcc       360
     gaggtcaacg ccctcctaga cgccaacgac tccgacgcga tccgcgcctg gctggagacc       420
     ggctaccgca tcgcccaggc cgaggacgac cgcgtcgcca tcgcccgcat cctcgccgac       480
     ccgtccatca gcccggccct gcgcgcggca gccaacgccg ccctcgacga caacacaccc       540
     gaagcactgc gccacttcct ggaagtcggc aggtaccagg tcgcctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page