(data stored in ACNUC7421 zone)

EMBL: BA000030.PE95

BA000030.PE95        Location/Qualifiers
FT   CDS_pept        104696..106234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_95"
FT                   /old_locus_tag="SAV_95"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_95"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67804"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RP8"
FT                   /protein_id="BAC67804.1"
FT                   /translation="MLRSPDGRVRVALIRTLRPLAVLAATAALFAGITDLPAAADGTAV
FT                   TKLTLGTDQFKMTDTNYESATNNLYNNVLTNHANLTDVVTTDYTKNSSGATDAWMNLRS
FT                   MRACAGSETQALPPVNKKVAWCWSSAHADDTTPRWFPQGMSTTGTADGGDGAIQGKHVS
FT                   AVAWHYKTFKTNSAGDLEANDGCKTNNLLKVSFIDRDTGKYRHVLLAEPTSTSSSASNF
FT                   KFVTGHGGGIVWYANYLYVTDTANGIRVFDINKLAKVDTYGSGLNSYGVSGGNSSACGY
FT                   PYVLPEVHYYKQASTPASCSTNAVDGTPDADALCYSWLSLDKTGAGPFKLVTGEWYGNV
FT                   AGGRVVRYQLNPTSASAYPGLLNMSGGKTVIQDAYAASGYQGLQGGMTWTDDAGLLNFA
FT                   FSKGCGTKPAVFSHTWAGDTRAVTSCAAGGNWAVGSPQALSYWPKLDTAQVDELWGLTE
FT                   GICAGTSLRASYPYEFPAVSESGNACTGYNSSDNLSLRSVFAVGFTDPAVQNLH"
     atgctccgtt cacctgatgg aagggtgcgt gtggcactca tacggacact cagaccgctg        60
     gccgtcctcg cggcgacagc cgccctgttc gccgggatca cggacctgcc cgcggccgcg       120
     gacggtaccg cggtgacgaa actgacgctc ggcaccgacc agttcaagat gaccgacacc       180
     aactacgagt cggcgacgaa caacctctac aacaacgtcc tgacaaacca cgccaacctc       240
     acggacgtcg tcaccaccga ctacacgaag aactcgtccg gggccaccga cgcctggatg       300
     aacctgcgtt ccatgcgcgc gtgcgccggc agcgagacgc aggcgctgcc gccggtgaac       360
     aagaaggtcg cctggtgctg gtcctcggcg catgccgacg acaccacgcc gcgctggttc       420
     ccgcagggca tgagcaccac cggcaccgcc gacgggggcg acggcgccat ccagggcaag       480
     cacgtctcag cggtcgcctg gcactacaag acgttcaaga ccaactcggc cggcgacctc       540
     gaggccaacg acggctgcaa gacgaacaac ctgctcaagg tctccttcat cgaccgggac       600
     accggcaagt accggcacgt cctgctcgcc gagccgacca gcacctcatc cagcgcctcg       660
     aacttcaagt tcgtcaccgg ccacggcggc ggcatcgtct ggtacgcgaa ctacctctac       720
     gtcaccgaca ccgccaacgg catccgcgtc ttcgacatca acaagctcgc caaggtcgac       780
     acctacggct ccggcctcaa ctcctacggc gtcagcggcg gcaactccag tgcctgcggc       840
     tacccgtacg tcctgcccga ggtccactac tacaagcagg cgtccacacc ggcctcgtgc       900
     tccacgaacg ccgtcgacgg gacccccgac gccgacgccc tgtgctattc ctggctctcg       960
     ctggacaaga ccggcgccgg cccgttcaag ctggtcacgg gcgagtggta cggcaatgtc      1020
     gccggcggcc gggtggtgcg ctaccagctc aacccgacga gcgcctcggc ctaccccggg      1080
     ctgctgaaca tgtccggcgg caagaccgtg atccaggacg cgtacgcggc ctccggctac      1140
     cagggactgc agggcggcat gacctggacg gacgatgcgg gcctgctgaa cttcgccttc      1200
     agcaagggct gcggcaccaa gcccgccgtc ttctcgcaca cctgggcagg tgacacccgg      1260
     gccgtgacca gctgcgcggc cggcggcaac tgggcggtcg gctcgccgca ggccctcagc      1320
     tactggccca agctcgacac ggcccaggtg gacgagctgt gggggctgac ggagggcatc      1380
     tgcgccggca cctcactgcg cgcctcgtac ccgtacgagt tcccggccgt ctccgagagc      1440
     ggcaacgcct gcaccggcta caacagttcg gacaatctgt cgctccgctc ggtcttcgcc      1500
     gtcggtttca ccgacccggc ggtccagaac ctgcactga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page