(data stored in ACNUC7421 zone)

EMBL: BA000030.PE96

BA000030.PE96        Location/Qualifiers
FT   CDS_pept        106628..107440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_96"
FT                   /old_locus_tag="SAV_96"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_96"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67805"
FT                   /db_xref="GOA:Q82RP7"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RP7"
FT                   /protein_id="BAC67805.1"
FT                   /translation="MAGQDVRGILPEGLGAAVRDTAEEIAALLRGGADMGRGVPGSQWT
FT                   VGQAAAHLAQAGELMADIAAGRARSWGDGTPQSLAAANERALAAFGERRAEPLAAMIVA
FT                   QADACVTALEESAAGAALVSPLGPMGPGVLGSYLLTHMLGHGYDLARALGCAHMIDRAR
FT                   VELTLPFLITAMPRVSEPARTAGLSASYAIRLWGGGRFGVRVAGGAVAVGPRPPDRPDC
FT                   TILIEPVTFLLMALGRRGQWSAIAQGRILAWGRRPWLAPRFPALFTAP"
     gtggctgggc aggacgtacg gggcatcctg cccgaggggc tcggtgcggc cgtacgcgat        60
     accgccgagg agatcgccgc gctgctgcgc gggggcgccg acatggggcg tggggtgccc       120
     gggtcgcagt ggaccgtcgg gcaggcggcg gcgcatctgg cgcaggcagg cgagctgatg       180
     gccgatatcg cggcgggacg cgcgcgcagc tggggggacg gcacgccgca gagccttgcc       240
     gcggccaatg agcgggcgct cgccgcgttc ggcgagcgga gggccgagcc gctggccgcg       300
     atgatcgtgg cgcaggccga tgcctgtgtg acggcgctgg aggagagcgc ggcgggggca       360
     gctcttgtct ccccgctggg tccgatgggc cccggtgtgc tggggtccta cctcctgacg       420
     cacatgctcg gccacggcta cgacctcgcc cgtgcgctgg ggtgtgcgca catgatcgac       480
     cgtgcccggg tggagctgac cctgccgttt ttgatcacgg ccatgccgcg ggtgagcgag       540
     cccgcccgca cggccgggct gagcgcctcc tacgcgatcc gcctgtgggg cggcggacgg       600
     ttcggtgtgc gggtggccgg cggtgcggtg gctgtggggc cgcggccgcc ggaccgcccg       660
     gactgcacca tcctcatcga gccggtcacc ttcctgctga tggcactggg ccgccgcggt       720
     cagtggagcg ccatcgccca gggccgcatc ctcgcctggg gccgcaggcc gtggctcgct       780
     ccccgcttcc cggctctctt cacagcgccc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page