(data stored in ACNUC7421 zone)

EMBL: BA000030.PKN1

BA000030.PKN1        Location/Qualifiers
FT   CDS_pept        complement(794749..795285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn1"
FT                   /locus_tag="SAVERM_639"
FT                   /old_locus_tag="SAV_639"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_639"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68349"
FT                   /db_xref="GOA:Q81ZZ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZZ1"
FT                   /protein_id="BAC68349.1"
FT                   /translation="MLFTNLDGVRNVVPVGHRQRRARPVGAGDVRAEKSLRYHLQEHGR
FT                   LPLNEAVAVLSDVAEALADLKDREIVHRDLKPENILLLGGRRCLADFGIARYAEATIAK
FT                   HTLKLAGTLAYMAPERWNNQRAASASDIYAPGVVAYELLEETPPFTGPYEHDYHDQHLH
FT                   GPVRPSPQLRPSWRR"
     ttgctgttca ccaacctgga cggcgtccgc aacgtcgtgc cggtcggtca tcgacagcgg        60
     cgagcacgac cagtgggcgc tggtgatgtc cgtgccgaga agtccctgcg ctaccacctc       120
     caggagcacg gccggctgcc cctcaacgag gcggtcgccg tcctgtccga cgtcgccgaa       180
     gcactcgccg acctcaagga ccgcgagatc gtccaccgcg acctcaagcc ggagaacatc       240
     ctgctgctcg gtggccgccg gtgcctcgcc gacttcggga tcgcccgcta cgccgaagcc       300
     accatcgcga agcacaccct caaactcgcg ggcaccctcg cgtacatggc ccccgaacgc       360
     tggaataacc agcgggccgc cagcgccagc gacatctacg ccccgggagt tgtggcgtac       420
     gagctcctgg aggaaacccc gcccttcaca ggaccgtacg agcacgacta ccacgaccag       480
     cacctgcacg ggcccgtccg cccctcacca cagctccgcc cgtcctggcg gcgctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page