(data stored in ACNUC7421 zone)

EMBL: BA000030.PNTA

BA000030.PNTA        Location/Qualifiers
FT   CDS_pept        complement(481356..482912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="SAVERM_404"
FT                   /old_locus_tag="SAV_404"
FT                   /product="putative pyridine nucleotide transhydrogenase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_404"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68113"
FT                   /db_xref="GOA:Q82QU1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU1"
FT                   /protein_id="BAC68113.1"
FT                   /translation="MSAQKPSHHPPRRIGVVAESVSGETRVAATPATVRLLLGLGYEVV
FT                   VESGAGEASGFGDQAYADAGAGIGEAWDADVVLKVNAPSDAEICRLRKGATVVALLTPA
FT                   QKPELLQALADAGVTALALDAVPRISRAQSMDVLSSMANIAGYRAVIEAAHAFGRFFTG
FT                   QVTAAGKVPPAKVLVAGAGVAGLAAIGAASSLGAIVRATDPRPEVADQVKSLGGEYLPV
FT                   EAVQESSTDGYAKATSADYDRAAAQLYHEQAEDVDMVITTALIPGRPAPRLLTAEDVAV
FT                   MKSGSVIVDMAAAMGGNVEGTVPGRTVVTDNGVTIIGYTDLASRLPAQASQLFGTNLLN
FT                   LLKLLTPGKDGQLTVDFDDVVQRAVTVVRDGDVTWPPPPVAVSAAPAAQPAAAPVAPEP
FT                   KQSNLTPAWRFGLIGLGMLAMFLLVAFAPTQLAGNFTVFALAVVIGYYVIGKVHHALHT
FT                   PLMSVTNAISGIVVIGALLQIGHESWIVTTLSFVAILLTSVNIFGGFAVTRRMLSMFSK
FT                   G"
     atgtctgctc aaaaaccctc acaccatcct ccccggcgca tcggcgtagt ggccgagtct        60
     gtctccgggg agacgcgggt cgcggcgacc ccggcgacgg tacgactgct gctgggcctc       120
     ggctacgagg tcgtcgtcga gtccggggcc ggtgaggcct ccggcttcgg tgaccaggcg       180
     tacgccgatg ccggcgcggg gattggcgag gcctgggacg cggatgtcgt gctgaaggtg       240
     aacgccccct ccgacgcgga aatctgccgg ttgcgaaagg gcgcgaccgt ggtcgccctg       300
     ctgaccccgg cgcaaaagcc cgagctgctt caggcgctcg ccgacgccgg ggtgaccgcc       360
     ctggcgctgg acgcggtgcc gcgcatttcg cgggcgcagt cgatggacgt gctgtcctcg       420
     atggcgaaca tcgctggtta ccgcgcggtc atcgaggccg cgcacgcctt cggacggttt       480
     ttcaccggcc aggtcactgc ggcgggtaag gtgccgccgg cgaaggtgct ggtggctggc       540
     gcgggtgtgg ccggtctcgc ggcgatcggt gccgcttcca gcctcggcgc gatcgtgcgc       600
     gccaccgacc cgcggccgga ggtcgcggac caggtgaagt cgctgggcgg cgagtacctg       660
     ccggtggaag ccgttcagga gtcgagcacc gacggctatg ccaaggcgac gtccgccgac       720
     tacgaccgcg ccgccgccca gctctaccac gagcaggccg aggacgtgga catggtgatc       780
     accaccgcgc tgatcccggg ccggccggcg ccgcgcctgc tgacggccga ggacgtggcc       840
     gtcatgaaat cgggcagcgt catcgtcgac atggctgccg cgatgggcgg caacgtcgag       900
     ggcaccgtgc cggggcggac ggtggtgacc gacaacggcg tcaccatcat cggctacacc       960
     gacttggcct cccggctccc ggcccaggcc tcgcagctgt tcggcaccaa cctgctgaac      1020
     ctgctgaaac tgctcactcc cggcaaggac gggcagctga cggtcgactt cgacgacgtt      1080
     gtgcagcggg cggtgaccgt ggtgcgcgac ggtgacgtca cctggccgcc gccgcccgtc      1140
     gcggtctcgg ccgcgcccgc cgcgcagcct gcggccgcac ccgtagcgcc cgaaccgaag      1200
     cagtcgaacc tgacgcctgc gtggcgcttc ggcctgatcg ggctcgggat gctcgcgatg      1260
     tttttgctgg tggccttcgc tcccacgcaa ctcgcgggca acttcaccgt gttcgcgctg      1320
     gcggtggtga tcggctatta cgtcatcggc aaggtgcacc atgcgctgca caccccgctg      1380
     atgtcggtga ccaacgcgat ctccgggatc gtcgtgatcg gggccttgct gcagatcggg      1440
     cacgagagct ggatcgtcac cacgctgtcc ttcgtggcga tcctgctgac gagcgtcaac      1500
     attttcggag gtttcgccgt cacccgccgc atgctgtcca tgttctcgaa aggctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page