(data stored in ACNUC7421 zone)

EMBL: BA000030.PNTB

BA000030.PNTB        Location/Qualifiers
FT   CDS_pept        complement(479883..481349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="SAVERM_403"
FT                   /old_locus_tag="SAV_403"
FT                   /product="putative pyridine nucleotide transhydrogenase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_403"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68112"
FT                   /db_xref="GOA:Q82QU2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU2"
FT                   /protein_id="BAC68112.1"
FT                   /translation="MTSLKASHAADLVAALLFILSLAGLSQHRTSRAGVVYGIAGMALA
FT                   LVATVVVAARSITAGAVALIVLAMALGAAMGLWRARRVEMTQMPELIAVLHSFVGLAAV
FT                   LVGWNSYLEVDSHGSAQTRIGANLLGIHHAEVFIGIFIGAVTFTGSIVAFLKLSARIKS
FT                   RPLMLPGKNALNLGALAAFVVLTIWFAISPNLPLMIAVTALALALGWHLVASIGGGDMP
FT                   VVVSMLNSYSGWAAAAAGFLLDNNLLIVTGALVGSSGAYLSYIMCKAMNRSFLSVIAGG
FT                   FGIAAPSGGEEEQGEHREVRAAEAAEMLAQARSVIITPGYGMAVAQAQHPVAELTRQLC
FT                   ERGIEVRFGVHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTSVVLVIGANDT
FT                   VNPAATEDPGSPIAGMPVLRVWEAEQVIVFKRSMASGYAGVQNPLFFRENSSMLFGDAK
FT                   QSVEEILHALSTDSRHDAAPAARQATVASH"
     atgacctccc tgaaggcttc acacgctgcc gacctggtcg ccgccctgtt gttcatcctc        60
     agcctggccg gcctgtccca gcatcgcacc tcccgcgccg gcgtcgtcta cggcattgct       120
     ggcatggccc ttgccctggt cgctaccgtg gttgtggcgg cgcggagcat caccgccgga       180
     gcggtcgcgc tgatcgtgct ggcgatggcg ctcggcgcgg cgatgggcct gtggcgggcc       240
     cgccgcgtcg agatgacgca gatgcccgaa ctgatcgctg tcctgcacag cttcgtcggc       300
     ctcgctgcgg tgctggtggg ctggaacagc tacctggagg tggattccca cggctcggcg       360
     cagacccgga tcggcgccaa cctgctgggc atccaccacg ccgaggtgtt catcgggatc       420
     ttcatcggcg cggtcacatt caccggctcg atcgtcgcgt tcctgaagct ctcggcgcgc       480
     atcaagtccc gtcccttgat gctgccgggc aagaacgcgc tgaacctcgg cgcgctcgcg       540
     gcgttcgtcg tgctgaccat ctggttcgcg atcagcccga acctacccct gatgatcgcg       600
     gtgaccgcgc tggcgctggc cctgggctgg cacctggttg cctcgatcgg cggtggcgac       660
     atgccggtcg tcgtctccat gctgaacagc tactcgggct gggcagcggc cgcggccggc       720
     ttcctgctcg acaacaacct gctcatcgtc accggcgcgc tggtgggctc ctccggtgcc       780
     tacctgtcgt acatcatgtg caaggcgatg aaccggtcgt tcctctccgt catagcgggt       840
     ggtttcggca tcgcggcgcc gtccggcggc gaggaggagc agggcgagca ccgcgaggtg       900
     cgggccgcgg aggcggccga gatgctggct caggcccgct cagtgatcat tacgcccgga       960
     tacggcatgg ctgtcgctca ggcccagcat ccggtcgcgg agctgacgcg gcaactgtgc      1020
     gagcggggta tcgaggtccg cttcggcgtt catcctgtcg ccgggcgcct gcccgggcac      1080
     atgaacgtgc tgctggccga ggcgaaggtg ccctacgaca tcgtcctgga aatggacgag      1140
     atcaacgacg acttcgccga cacctcggtc gttctggtca tcggtgcgaa tgacaccgtc      1200
     aaccccgccg cgaccgagga cccgggcagc ccgatcgccg gcatgccggt gctgcgggta      1260
     tgggaagccg agcaggtcat cgtcttcaaa cgctccatgg cctccggcta tgcgggcgtg      1320
     cagaacccgc tcttcttccg cgagaacagc agcatgctct tcggcgacgc caaacagagc      1380
     gtggaggaga tcctgcacgc gctcagcacc gacagccgac acgacgcggc cccggccgca      1440
     cgccaggcga cggtggccag ccactga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page