(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPJ1

BA000030.PRPJ1       Location/Qualifiers
FT   CDS_pept        742052..744481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpJ1"
FT                   /locus_tag="SAVERM_587"
FT                   /old_locus_tag="SAV_587"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_587"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68297"
FT                   /db_xref="GOA:Q82QC3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QC3"
FT                   /protein_id="BAC68297.1"
FT                   /translation="MDKENAKNAYSAGASQGSTGVSGSGPGGRRCACDGPAAAVLDDRG
FT                   AVVGWTETAEDLTGFRAGEVCGRPVQELVADLPDHLRGATDMPESGRVRLRHQCGDTID
FT                   VTFRTTRVQGSAQVLVLAAPTHHVADHKQGTALLRALSAQNRITIALYDTDLATVQTNA
FT                   KPDTPDGLPVQPGTRLSDVLCADDAENLEAVLRQVLETGVPVVRRTQQVSWRHNSARRH
FT                   TLSLSAFRLEDVRARPTGVAALYIDSDDLRARRHLDLAREVAERVGGSLDVVRTAQDLA
FT                   DVLAPAFGDLAAVDLAYSVLDGEEPSKQLNGGNMGNAALAPATAVWPAGIKRGESIPPL
FT                   PDHPLWRSFRHGEPAVFSLDDFIAMVGDPQLVKYLAPKDAHSMMVAPLHARGLTLGAIS
FT                   VWRCGRSDPFTEDEADLMKQIASRGALAIDNARRYTREHRAAVALQQLLLPPATTDTPA
FT                   AETAGVHLPAGGEADISGDWYDAIALPSLRLALVAGDVVGHGMSASAAMGSLRAAIRTL
FT                   ADLELEPDELLTRLADLVQRLAAEAPSGDCDIVGGTCLYAVYDPVTRRCAMASAGHPPP
FT                   VLVRPDGTAEAVGISPGPPLALSGMPYETTIIDVEPGSVLALYTDGLVERSDRDIGQGL
FT                   RRLTEALAAYCRPDRALDETGRALLADLADQAPRDDGALLLARTRAVPAADTAHWEIPA
FT                   DPAAVAKAREWTTRQLTLWGLDDLLFATELIVSELVTNAIRYGRPPMDLRLIRHNALVC
FT                   EVTDSSSTQPRLRRARTTDEGGRGLFLVAQLGGRWGCRHVQNGKTIWSEQVIQDSS"
     atggataaag agaatgccaa gaacgcctac tcggcaggcg cctcccaagg atcgacgggc        60
     gtctccggtt ccggtcccgg cggcaggcga tgcgcctgtg acggcccggc agccgccgtg       120
     ctcgacgatc gaggcgcggt ggtggggtgg accgagacgg cggaggacct gacggggttc       180
     cgcgccgggg aggtctgcgg ccgccccgtg caggaactgg tggccgacct cccggaccac       240
     cttcgcggcg ccacggatat gccggaatcc gggcgggtac ggctgcggca ccagtgcggc       300
     gacaccatcg acgtcacttt ccggaccaca agggtgcagg gctcggcgca ggtcctcgtc       360
     ctggcggcac ccacacacca cgtcgccgac cacaagcagg gcacagcgct cctgcgcgca       420
     ctgtccgcac agaaccggat cacgatcgcc ctgtacgaca ccgacctggc cactgtgcaa       480
     acgaacgcca agccggacac tcccgacggc cttccagtac agcccggcac tcggctgagc       540
     gacgtgctgt gcgccgatga cgccgagaac ctggaggcag tactgcgcca ggtgctcgag       600
     acgggtgtcc cggtggtccg cagaacccag caagtgagct ggcggcacaa ttcggcgcgg       660
     cggcacacgc tgtcgctgtc tgcctttcgt ctggaggacg tgcgagcacg ccccacgggg       720
     gtcgcagccc tgtacatcga cagcgacgac ctgcgtgccc gccgtcatct ggatctcgcc       780
     cgcgaggtgg ccgagcgagt aggaggatcc ctggatgtcg tgcgcaccgc acaggacctt       840
     gcggacgttc tcgcacctgc gttcggggat ctcgccgcag tcgaccttgc gtactccgtt       900
     ctcgacgggg aagaaccctc gaagcagctg aacggtggaa acatgggcaa cgcggccctt       960
     gcgccggcca ccgcggtgtg gccggccggc atcaagcgcg gcgagtccat cccgcccctt      1020
     cccgaccacc ccctgtggcg cagtttccga cacggcgagc cagccgtctt cagccttgac      1080
     gacttcatcg ccatggtcgg cgacccgcag ctggtcaagt atctcgcccc gaaggacgcc      1140
     cattcgatga tggtggcacc gttgcatgcc cgcgggctca cgctcggcgc catatcggtc      1200
     tggcgctgcg gccgatccga ccccttcacc gaggacgagg cggatctcat gaagcagatc      1260
     gcctcacggg gtgcgctcgc catcgacaac gcccgccgtt acacgcgcga gcaccgggcg      1320
     gccgtagcgc tgcagcagct cctccttccc ccggccacca ccgacacgcc ggccgccgag      1380
     accgccggcg tccacctgcc cgcaggcggg gaagcggaca tcagcggcga ctggtacgac      1440
     gccatcgctc tgccctctct ccggctggca cttgtcgccg gagacgtggt cggccacggc      1500
     atgtccgcaa gcgccgccat gggcagcctg cgcgccgcca tccggacgct cgcggacctg      1560
     gagctcgaac cggacgagct gctcacccgg ctcgcggacc tggtccagcg cctcgcggcc      1620
     gaagccccgt ccggcgactg cgacatcgtc ggcggaacgt gcctgtacgc ggtctacgac      1680
     ccggtcaccc gccgctgcgc catggccagc gccgggcatc cgccacccgt cctggtgcgg      1740
     cccgacggga ccgccgaagc agtcggtatc tccccggggc caccactcgc cctgagcggc      1800
     atgccgtacg agaccaccat catcgacgtc gagccgggca gcgtcctcgc tctctacacc      1860
     gacggcctgg tcgaacggag cgatcgcgac atcggccaag gcctgcggcg cctgacggaa      1920
     gccctcgccg cgtactgccg tccggatcgc gccctggacg aaaccggccg tgctctcctc      1980
     gccgatctgg cagaccaggc gccgcgcgac gacggggccc tactgctggc ccgcacccgc      2040
     gccgtcccag cggcggacac cgctcactgg gagatcccgg ccgatcccgc cgccgtcgca      2100
     aaggctcgag agtggacaac ccgtcaactc accttgtggg gcctggacga cctcctcttc      2160
     gccaccgaac tcatcgtcag cgaactggtg accaacgcca tccgctacgg tcgtccgccg      2220
     atggacctcc gtctgattcg ccacaacgcc ctggtgtgcg aggtcaccga ctccagcagc      2280
     acccagcccc gcctgcggcg tgcccgcaca accgacgagg gaggacgcgg cctgttcctc      2340
     gtcgctcaac tcggcggacg atggggctgc cgccacgtcc agaacggcaa gacgatctgg      2400
     tccgagcaag tcatccagga ttcctcctga                                       2430
//

If you have problems or comments...

PBIL Back to PBIL home page