(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPL1

BA000030.PRPL1       Location/Qualifiers
FT   CDS_pept        739502..741964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpL1"
FT                   /locus_tag="SAVERM_586"
FT                   /old_locus_tag="SAV_586"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_586"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68296"
FT                   /db_xref="GOA:Q82QC4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QC4"
FT                   /protein_id="BAC68296.1"
FT                   /translation="MTKTDHTPLAEPVSPRETPDAAIAMLDAEGTVVGWTHAAEQLVGY
FT                   SAGEVVGRSATHVLPPAEDVPSASVFAEQGRALDGWSGAVTVRHRDGHAIKMTLRISLL
FT                   WGQDAGTRWLVSVTDIGTLSSGTSDEAVRESLLAHAPVGIAVYDPRLRCTWVNDVMERH
FT                   DGTPRERRFGRRLRDSLPAVEAEALEVVMRQVLESGTTMVHEYRAWSSTDQRREHAFSA
FT                   SFFCLQDADGTALAVCSMSVDVTGNRRARERLAILSEASTRIGSTLEVMRTGQELADLA
FT                   VPLLADHAIVDLMESVPFGVDPSAGTGTAANDRPPVLRRAGVASVDPGILKLLMRQEVI
FT                   RPFPTSLFATVLRTGRSYLESVLDTYSGPWILHDPARTQMVRDSGVHSLMVVPIRARRC
FT                   ALGLAVFCRSEEPTPFQEDDLLLAEELVTRAALSLDNALQYARQRTAALTLQRDLLPHH
FT                   VGGGAALDVASRYVPADIDHGVGGDWFDVIKLSGARVALVVGDVVGHGINAAVTMGRLR
FT                   TAVRTLANMELPPHELLAHLDDTVKRLSEEDADAPDQLPPAVGATCLYAVYDPVTRRCT
FT                   MSRAGHPPPAIIDPQGRATFPDMPAGAPLGLGLGLVPFESVELELPEGTLLALYTDGLV
FT                   ESRDDDIDVGLDRLGAALAESGSALEDLCSQVIETLPTQAPADDVTLLLARTRGLEPAQ
FT                   VASWELPNEPAAVRIARQAAARQLSEWGLDHLVTTEQLIVSELVTNAIRYSGGPIRLRL
FT                   IQHQVLTCEVSDSNPSHPRPRQPHTIDENGRGLSLVAQLSHRWGSRSATDGKIVWAEQD
FT                   LPSKALAA"
     atgacgaaga ccgaccacac gccactcgcc gagccggtga gcccccgaga gacacccgat        60
     gccgcaatag cgatgctcga cgcggagggg accgtggtgg ggtggacgca cgccgctgag       120
     cagcttgtcg ggtactcggc cggggaagtg gtgggccggt ccgccacaca cgtgctgccg       180
     cccgccgagg acgtcccgag tgcttcagtg ttcgccgagc agggccgtgc cctggatggc       240
     tggtccggcg ccgtgacggt ccgccaccgc gacggccacg ccatcaaaat gacgctgcgg       300
     atctcgctgc tgtgggggca ggacgccgga acccggtggc tggtgtccgt gaccgacata       360
     ggcaccctgt cctcggggac gtccgacgaa gccgtgcggg agtcgctcct ggcccacgcg       420
     ccggtcggca tcgcggtcta tgacccgcgg ctgcgctgca cctgggtcaa cgacgtcatg       480
     gagcgccacg acggcactcc tcgtgagcga cggttcgggc gccgcctgcg ggactcactg       540
     cccgccgtgg aggccgaagc gctcgaggtg gtgatgcggc aggtgctgga gagcggcacc       600
     accatggtcc acgagtaccg ggcgtggtcg tcgacggacc agcgccggga gcacgcgttc       660
     tcggcctcgt tcttctgcct ccaggacgcg gacggcacgg cactggccgt gtgctcgatg       720
     agcgtggacg tcacgggcaa ccggcgggcg cgcgagcgtc ttgccatcct cagcgaagcc       780
     agcacgcgca tcggcagcac cctcgaggtc atgcggaccg ggcaggaact ggccgacctc       840
     gccgtgcccc tgctggccga ccacgcaatc gtcgacctga tggagtcggt tccgttcggc       900
     gtggatccct cggcggggac cggcacggcg gcgaacgacc gcccacctgt gctgcgccgt       960
     gccggtgtgg cctccgtcga cccgggcatc ctcaagttgc tgatgcgcca agaggtgatc      1020
     cgccccttcc cgacctcgct gttcgccacc gtcctgcgca cgggcaggtc ttacctggaa      1080
     tcggtgctgg acacctattc aggcccctgg attcttcacg acccggcgcg gacgcagatg      1140
     gtccgtgaca gcggcgtcca ctctttgatg gtcgtaccca tccgtgcgcg gcgctgtgcg      1200
     ctgggactgg cggtgttctg ccgctccgag gagccgacgc cgttccagga ggacgacctc      1260
     ctgctcgcag aggaactcgt cacccgggcc gcgctcagcc tggacaacgc tctccagtac      1320
     gctcgccaac gcaccgcggc cctgacgctc caacgcgacc tgctccccca ccatgtggga      1380
     ggtggcgccg ccctcgatgt ggcctcgcgc tacgtgccgg ctgacataga ccacggcgtg      1440
     gggggcgact ggttcgacgt gatcaagctg tccggcgcca gggtggccct cgtcgtcgga      1500
     gatgtggtcg gacacggcat caacgccgcg gtgacgatgg gccgattgcg caccgccgtc      1560
     cgcacgctcg cgaacatgga actgcctccg cacgaactgc tggcgcacct cgatgacacg      1620
     gtcaagcggc tgagcgagga agacgccgac gctccggacc agctcccccc ggcggtgggc      1680
     gccacgtgtc tgtatgccgt ctacgacccg gtcacccggc ggtgcacgat gtcgcgggcc      1740
     gggcatcccc cgcccgcgat catcgacccg cagggccgtg ccactttccc cgacatgccc      1800
     gccggggccc cgctcggcct cggcctcggt ctggtcccct tcgagtccgt ggaactggaa      1860
     ctgcccgagg gcactctgct cgcgctctac accgacggtc tggtcgagtc ccgcgacgac      1920
     gacatcgacg tgggcctcga ccgcttgggc gccgccctgg cagagtccgg ttcggccctg      1980
     gaagacctgt gctcccaggt gatcgagacc ttgccgactc aggccccggc cgacgatgtc      2040
     accttgctcc ttgcgcggac tcgcggactc gaaccggccc aggtcgcctc ctgggagctg      2100
     ccgaacgagc cggccgccgt ccgcatcgcc cggcaggcag ccgcccgtca gctcagcgaa      2160
     tgggggctcg atcatctggt gaccaccgag cagctgatcg tcagtgaact ggtcaccaac      2220
     gccatccgct acagcggcgg gccgatccgc ctacgactca tccagcacca ggtcttgacc      2280
     tgcgaagtct ccgacagcaa ccccagccac ccacgccccc gtcagcccca caccatcgac      2340
     gagaacggcc gcggcctttc cctcgtcgcc cagttgtccc accggtgggg ctcccgctcc      2400
     gcaaccgacg gcaagatcgt ctgggccgaa caagacctgc cctccaaagc cctcgcggcg      2460
     tga                                                                    2463
//

If you have problems or comments...

PBIL Back to PBIL home page