(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPM1

BA000030.PRPM1       Location/Qualifiers
FT   CDS_pept        complement(587625..590051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpM1"
FT                   /locus_tag="SAVERM_437"
FT                   /old_locus_tag="SAV_437"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_437"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68147"
FT                   /db_xref="GOA:Q82QR8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QR8"
FT                   /protein_id="BAC68147.1"
FT                   /translation="MHDITFRGDGEFPEPGSEADVLLDACGRVAAWGPGAQQMLGCPAR
FT                   EAVGRSADEFLYDPADAADIVRRWEKGARRGSLVLRQRSGKPLAAQIWVRALTSANGDP
FT                   QWLVQAARTAVLRTYEYGRALLKGLFTDSPFNIDIFDTQLRFVGLNIAERRAGVFQGTE
FT                   YSGHTMREMAPPGLLDVDALEARQRRVLETGKALIDTEVVGHPVANSPREYVWSESILP
FT                   LRDPSGRVIALGHVVSDVTQRVRSRERLVLTNEAAIGIGTTLDLWRTARELAEVAVPRF
FT                   ADICFVDLLDSVFPGREPTEGRPPRPPLFRRAACSGAAEDTGSDAAGEVKVGDANLWAT
FT                   APGSPFLDALTKGESVLLADDQLQNCPAAVGLRHSPDDGPKIHSWLLVPMFARGVVLGA
FT                   VVFLRSGNPRRFEPDDVLLAEEIVTRAAVCVDNASRYHRERTTALTLQRSLLPQRLPSA
FT                   SAVRTASCYLPASGHTGLGGDWFDVIPLSGARVALVVGDVTGHDLQSAVTMGRLRSAVR
FT                   TLADLDLAPDELLTHLDDQMNRFLDERSDEGPLATGATCLYAVYDPVSRRCLLARAGHP
FT                   PPAVLSVNGAVDFVELPGGPPLGLGGIVFEKREIAMDDGDVLVLYTNGLLQPRAQDLDA
FT                   GLHRMRDTLSRTPPSATPQEVCDTLVRELLPTCHKDDVAVLTARVSGLASDRHVTWKIE
FT                   AQDELVGRARDLTTQQMARWGLEEESFTTELIVSELVTNAIRYGEEPITLRLILDRNVI
FT                   CEVSDGSSTSPHVRRAQDTDEGGRGLYLITQLTRSWGTRYGERGKTIWAEQPLRC"
     atgcatgaca tcacctttcg cggcgacggt gaatttccgg aaccgggaag cgaggcggac        60
     gtcctgctgg acgcctgcgg tcgggtcgcg gcctggggtc cgggagcgca gcagatgctc       120
     ggctgtccgg cgcgcgaggc tgtgggccgt agtgcggacg agttcctcta cgaccccgcc       180
     gacgcggcgg acatcgtcag gcgctgggag aagggcgccc gccgggggtc tctggtcctg       240
     cgacagcgca gcgggaagcc gctggcggcc cagatctggg tccgtgccct cacgtccgcg       300
     aacggtgatc cgcagtggct ggtgcaggcg gcccgtaccg ccgtactccg cacgtacgaa       360
     tacgggcgcg ccctgctgaa ggggctgttc accgactcgc cgttcaacat cgacatcttc       420
     gacacgcagc tgcgcttcgt cggcctgaac atcgccgagc ggcgcgccgg cgtgttccag       480
     gggaccgagt actccgggca caccatgcgc gagatggcgc cgcccggcct gctggacgtc       540
     gatgccctcg aagcccgcca gcggcgggtc cttgagaccg gcaaggcgct catcgacacc       600
     gaggtggtcg gccaccccgt ggccaactcg ccgcgggagt acgtgtggtc ggagtccatc       660
     ctgcccctga gggacccgtc cgggagggtg atcgcgttgg gtcatgtcgt ctccgacgtg       720
     acccaacggg tccgatcgcg cgagcggctg gtcctgacga acgaggcggc catcgggatc       780
     ggcaccaccc tggacctttg gcgcaccgcc cgggaactgg ccgaggtcgc ggtaccgcgc       840
     ttcgccgaca tctgctttgt cgacctgttg gactcagtct tccccggccg cgaaccgacc       900
     gaaggccgac caccgcgtcc cccgctgttc cgcagggccg cttgcagtgg ggcagccgaa       960
     gacacggggt cagacgctgc cggggaagtg aaggtggggg atgccaattt gtgggcgacg      1020
     gcgcccggct cgccgttcct cgacgctctc acgaagggtg aatccgtcct cctggcggac      1080
     gatcaactcc agaactgccc cgccgcagtc ggcctccgcc actccccgga cgacggaccg      1140
     aagatccatt cgtggctgct cgtcccgatg ttcgcccgcg gcgtcgtcct gggcgctgtc      1200
     gtcttcctgc gctccggcaa cccccgccgg ttcgagcccg acgacgtgct gctggcggag      1260
     gagatcgtga ccagagcggc ggtgtgcgtc gacaacgcca gccgatacca ccgcgagcgg      1320
     acgaccgcgc tgaccctcca gcgcagtctc cttcctcagc ggctgccgtc ggcgtcggcg      1380
     gtgcggacgg cgtcctgcta cctgcccgcg agcgggcaca ccgggctggg cggcgactgg      1440
     ttcgacgtca tccctctgtc cggcgcacga gtggcgctcg tggtgggcga cgtgaccgga      1500
     cacgacctgc agtccgctgt gaccatgggc cgcctgcgca gcgccgtacg tacgctcgcg      1560
     gatctcgatc tggcccccga cgagcttctc acccatctcg acgaccagat gaaccgcttc      1620
     ctcgacgaac ggagtgacga agggcccctg gcgacaggag cgacgtgcct gtacgcggtg      1680
     tacgaccccg tgtcccgccg ctgtctcctg gcacgcgccg gtcatccacc gccggctgtg      1740
     ctctcggtga acggcgccgt cgacttcgtg gaactgcctg gcggcccccc actgggcctg      1800
     ggaggtatcg tgttcgaaaa gcgtgagatc gccatggacg acggggacgt tctggtgctg      1860
     tacaccaacg gcctgctgca gccgcgcgcc caggatctcg atgccggact gcaccgcatg      1920
     cgcgacaccc tttcgcggac tcctccatcc gccacgcctc aagaggtgtg cgacacgctg      1980
     gtccgcgaac tgctgccgac atgccacaag gacgacgtgg ccgttctgac ggcccgggtc      2040
     agcggcctgg cttcggaccg ccatgtcacc tggaagatag aggctcagga cgaactggtc      2100
     ggccgggcac gcgacctgac gacgcagcag atggcccggt gggggctgga ggaggagtcg      2160
     ttcaccaccg agctgatcgt cagcgagctg gtgacgaacg cgatccgcta cggcgaagaa      2220
     ccgatcacgc tacggctgat cctcgaccgc aacgtgatct gcgaggtgtc ggacggcagc      2280
     agcacatctc cccacgtcag acgggcccag gacacggacg agggcggacg cggtctctac      2340
     ctcataaccc agctgacccg gagctgggga acccggtacg gcgaacgcgg caaaaccatc      2400
     tgggccgaac agccactacg ctgctga                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page