(data stored in ACNUC7421 zone)

EMBL: BA000030.RHSA

BA000030.RHSA        Location/Qualifiers
FT   CDS_pept        complement(25699..29451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhsA"
FT                   /locus_tag="SAVERM_21"
FT                   /old_locus_tag="SAV_21"
FT                   /product="putative Rhs protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_21"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67730"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RX1"
FT                   /protein_id="BAC67730.1"
FT                   /translation="MTLSGLVSTAAHPERVVQAAVDGFKKDPSEFVGRLIPELIGTKGA
FT                   GLARGGMRLALKEGMEGVAEQGLRKTARNAVEDAAEDASRQRGAKICEKDPVDVATGRM
FT                   VLPQIDVSLPGQLPLVVKRQFESSYRLGGWFGPTWSSTLDQRLEVDTAGVVLVGEDGLV
FT                   LAYPHPAPGVPTLPSHGPRWSLDRTDGGYTLTDQKSGHIRHFVDRSDTLAVLEQLDDRN
FT                   GNWITFEYDADGAPRYLTHSGGYRLRISTEAGRVTALHLASAAVDGGDQDLIRYGYTDG
FT                   HLTEVVNSSGRPLQYVCDELGRITSWTDTNDSHFSYAYDDEDRCTHQSGAAGHLRSTFA
FT                   YGAVDPGTGAHTTTVTDSYGQTTHYLINRRCQVIAETDALGAVTRYQRDRYNRLLSQTD
FT                   PLGHTTSFRYDDAGNLVAATRPDGREARAEYNALGLPVKLVNPDGTITRQTFDERGNLT
FT                   SVTDPSGQTTRFGYDEGGRLTSMTDPLGHTTGIVCDRAGLPLTVTDPLGAVTRYERDAF
FT                   GRTTAITDPTGATTRLEWTVEGHLSRRTAPDGTSESWTYDGEGNCTSHTDPVGGVSLFE
FT                   YTHFDLPTARTGPDGVRYEFEHDTELRLSQVTNPHGLTWNYAYDAAGRLVAETDFDNRT
FT                   LTYEYDFAGRLASRTNALGQMIAFERNELGQIVRKDAAGQATTYAYDFTDQLAQATGPD
FT                   GTALTILRDRHGRMISEAVNGRALTYDYDELGRRTRRTTPSSATTIWSYDVAGRRTSMT
FT                   GSGRSIDFVYDEAGRELGRRFGHITLEHSFDALGRLTSQSVLGPAGRRTQHRQYTYRAD
FT                   GHLIGIEDQLSGKRRFDLDLAGRVTAVHAVNWTETYAYDAVGNQTSASWPAGHPGQEAI
FT                   GNRTYTGTSLTRAGQVRYEHDGLGRIILRQKTRLSRKPDTWRYTWDAEDRLTSVTTPDG
FT                   TRWRYTYDPLGRRTAKLRLAEDGETLVERVDFTWDGTVLCEQTTTSPDLPHQVTLTWDH
FT                   QGLRPVTQTERIVAADAPQQEIDSRFFAIVTDLVGTPSELLDERGEIVWRTRATLWGST
FT                   TWAKNSTAYTPLRFPGQYYDPETGLHYNYFRHYDPETARYVTPDPLGLGPAPNPAAYVP
FT                   NPHMWADPLGLKCEPPEGYTSQPAFKNDPYHPDAVERGINEMRELYGIKERPPSGMIGA
FT                   NGTQVTSKTMWNHGPYRIDVENPNPGQRAGQLHFQDQSNPTAKYQYNFDEGKFDGLPRS
FT                   VEREVGKIPGFEAGIRKGLRVLGED"
     atgacgctct ccggcctggt ctccaccgcc gcacaccccg aacgggtcgt ccaggccgcc        60
     gtggacggct tcaagaagga cccctcggag ttcgtcggcc gcctcatccc ggaactcatc       120
     ggcaccaagg gcgcgggact ggcccgcggc gggatgcggc tcgcgctgaa ggagggcatg       180
     gagggggttg cggagcaggg gctgcgcaag accgcgcgga acgcggtgga ggacgcggcc       240
     gaggacgcgt cgcggcagcg gggcgcaaag atctgcgaga aggaccccgt cgatgtcgcg       300
     accggccgga tggtactgcc acagatcgac gtctcgcttc cggggcagct gcctctggtc       360
     gtcaagcgcc agttcgagtc gtcgtaccgg ctgggcggct ggttcggccc gacgtggtcc       420
     tcaacgctcg accagcgcct ggaggtcgac acggcgggtg ttgtcctcgt cggcgaggac       480
     ggcctggtgc tcgcctaccc acacccggcc cccggcgtgc ccaccctgcc cagccacggt       540
     ccgcgctggt cactcgaccg cacggacggc ggctacacgc tgacagacca gaagtcgggc       600
     cacatacggc acttcgtcga ccgctccgac actctggcgg tgctggagca gctcgacgac       660
     cgcaacggca actggatcac gttcgagtac gacgccgacg gcgcaccccg gtatctcacc       720
     cacagcggcg gctaccgcct gcgcatatcc acggaggccg ggcgtgtcac cgcgctgcac       780
     ctggccagcg cggccgtgga cggcggggac caggatctga ttcgctacgg ctacaccgac       840
     ggccacctca ccgaggtcgt caactcctcc ggccgccccc ttcagtacgt gtgcgacgaa       900
     ctcggccgca tcacctcctg gaccgacacc aacgacagcc acttcagcta cgcctacgac       960
     gacgaagacc gctgcaccca ccagtcgggc gccgcgggcc acctgcgctc aaccttcgcc      1020
     tacggggcag ttgaccccgg caccggcgca cacacgacga ccgtcacgga ctcatacggt      1080
     caaaccaccc actacctgat caaccgacgc tgtcaggtga tcgctgagac ggacgcactc      1140
     ggcgcggtca cccgctacca gcgcgaccgc tacaaccggc tgctgtccca gaccgacccc      1200
     ctcgggcata cgacctcgtt ccgctacgac gacgcaggca acctcgttgc agcgacccgc      1260
     ccggacggcc gcgaggcacg ggccgagtac aacgccctcg gcctgccggt gaaactggtc      1320
     aatccggatg gcacgatcac ccggcagacc ttcgacgaac gcggcaacct cacctcggtc      1380
     accgacccgt ccggtcagac cacccgcttc ggctacgacg agggtggtcg tctcacgtcg      1440
     atgactgatc cgctcggtca caccaccggc atcgtctgcg accgggccgg actgccgttg      1500
     acagtcaccg accccctggg cgcggtgacg cgatacgagc gcgacgcctt cggccgcacc      1560
     actgcgatca ctgatccaac cggcgccacc acacggctgg agtggacagt ggagggccac      1620
     ctgtctcggc gcacagctcc cgacggcacg agtgagtcgt ggacatacga cggtgagggc      1680
     aactgcacca gccacaccga cccggtcggg ggcgtgagtc tgttcgagta cacgcacttc      1740
     gacctgccca ccgcccgcac cggcccggac ggggtgcgct acgagttcga gcacgacacc      1800
     gagctacgcc tgtcccaggt caccaacccc cacggcctta cctggaacta cgcctatgac      1860
     gcggccgggc ggctggtcgc ggagacggac ttcgacaacc gaaccctcac ctacgagtac      1920
     gacttcgcag gccgcctcgc ctcgcgcacc aacgccctcg gccagatgat cgccttcgag      1980
     cgcaacgaac tgggccagat cgtgcgcaag gacgccgccg gacaggccac gacgtacgcc      2040
     tacgacttca ccgaccagct ggcgcaggcc accggtccgg acggcaccgc gctcaccatc      2100
     ctgcgcgacc gccacggccg tatgatttcg gaagcggtca acggccgggc actgacctac      2160
     gactacgacg agctcggtcg ccgtacccgc cgcaccaccc ccagcagcgc cacgaccatc      2220
     tggtcctacg acgtggccgg gcgccgcacc agcatgaccg gctccggtcg gagcatcgac      2280
     ttcgtctacg acgaggcagg ccgcgagctt ggccgccgct tcggccacat caccctggaa      2340
     cactccttcg acgccctcgg ccgcctgaca tcccagtccg tgctgggtcc ggccggtcgc      2400
     aggacgcagc accgccagta cacctaccgc gccgacggcc acctgatcgg catcgaggac      2460
     caactctcgg gcaagcgccg cttcgatctg gacctggccg gccgggtgac ggccgtccat      2520
     gcggtgaact ggaccgagac ctacgcctac gacgcggtgg gcaaccagac gtcggcctcc      2580
     tggccggcgg gtcatcccgg ccaggaagcg atcggcaatc gcacatacac gggtaccagt      2640
     ctcacgcgcg ctggccaggt ccgctacgaa cacgacggcc tcggccgcat catcctgcgc      2700
     cagaagaccc gactgtcccg caaacccgac acctggcgct acacctggga cgccgaagac      2760
     cgcctgacct ccgtgaccac cccggacggc acccgctggc gctacaccta cgacccgctg      2820
     ggccggcgca ccgccaaact ccgcctcgcc gaagacggcg aaaccctcgt cgagcgagtc      2880
     gacttcacct gggacggcac ggttctgtgc gagcagacca ccacatctcc cgacctgccc      2940
     caccaggtca ccctcacctg ggaccaccag ggcctacggc cggtcacgca gaccgaacgt      3000
     atcgtcgcgg ccgacgcacc ccagcaggag atcgactccc gcttcttcgc catcgtcacc      3060
     gacctcgtcg gtaccccgag cgaactcctc gacgagcggg gagagattgt ctggcgcacc      3120
     cgtgccaccc tgtggggcag caccacctgg gcgaagaaca gcacggcata cacgccgctg      3180
     cgtttccccg gccagtacta cgaccccgaa accggcctgc actacaacta cttccgtcac      3240
     tacgaccccg agaccgcccg ctacgtcacc cccgaccccc tcggactcgg ccccgcgccc      3300
     aacccggccg cctacgtgcc caatccccat atgtgggccg acccgctcgg gctgaagtgc      3360
     gagccgccgg agggatacac ctcccagccc gctttcaaga acgatcccta ccaccccgac      3420
     gcggtggagc gggggatcaa cgagatgcgc gagttgtacg ggatcaagga acgtccgccg      3480
     agcggcatga tcggagccaa tgggacccag gtgacaagca agaccatgtg gaatcacggg      3540
     ccgtaccgga tcgacgttga gaatccgaat ccagggcagc gggccgggca gctgcatttc      3600
     caggaccaga gcaaccccac cgcgaagtat cagtacaatt tcgacgaagg gaagttcgac      3660
     ggattgccgc gttcggttga acgggaagtc ggcaagattc ctggtttcga agcgggtatc      3720
     cgcaaggggc tcagggttct gggagaggat tag                                   3753
//

If you have problems or comments...

PBIL Back to PBIL home page