(data stored in ACNUC7421 zone)

EMBL: BA000030.RPOA2

BA000030.RPOA2       Location/Qualifiers
FT   CDS_pept        594232..595248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA2"
FT                   /locus_tag="SAVERM_440"
FT                   /old_locus_tag="SAV_440"
FT                   /product="putative RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68150"
FT                   /db_xref="GOA:Q82QR5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q82QR5"
FT                   /protein_id="BAC68150.1"
FT                   /translation="MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSIRVDGVLHEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGL
FT                   VTAADIAPPAGVEVHNPDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIP
FT                   VDSIYSPVLKVTYKVEATRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLA
FT                   RELNIDAEGIDMGPSPVDAALAADLVMPIEELELTVRSYNCLKREGVHSVGELVARSEA
FT                   DLLDIRNFGAKSIDEVKAKLAGMGLGLKDSPPGFDPTAAALGADDDADAGFLETEHY"
     gtgctgattg ctcagcgtcc gtccctgacc gaagaggtcg tcgacgagtt ccgctcccgg        60
     ttcgtgatcg agccgctgga gccgggcttc ggctacaccc tcggcaactc cctccgccgg       120
     accctcctgt cctcgatccc gggtgcggcg gtcacgtcca tccgcgtcga cggcgttctg       180
     cacgagttca ccaccgtgcc gggtgtcaag gaggacgtca ccgacctgat cctcaacatc       240
     aagcagctgg tcgtctcctc ggagcacgac gagccggtcg tgatgtacct gcgcaagcag       300
     ggtccgggtc tggtcaccgc cgccgacatc gcgcccccgg ccggtgtcga ggtgcacaac       360
     cccgacctcg tcctcgccac gctcaacggc aagggcaagc tggagatgga gctgaccgtc       420
     gagcgcggtc gcggctacgt ctccgccgtt cagaacaagc aggtcggtca ggagatcggg       480
     cgcatcccgg tcgactcgat ctactcgccg gtgctgaagg tcacgtacaa ggtcgaggcg       540
     acccgtgtcg agcagcgcac cgacttcgac aagctgatcg tcgacgtcga gaccaagcag       600
     gccatgcgtc cccgtgacgc catggcgtcg gccggcaaga cgctggtcga gctgttcggt       660
     ctcgcccgcg agctcaacat cgacgccgag ggcatcgaca tgggcccgtc cccggtggac       720
     gccgccctcg ccgccgacct ggtgatgccg atcgaggagc tggagctcac ggtccggtcg       780
     tacaactgcc tcaagcgcga gggcgtccac tccgtgggtg agctcgtcgc ccgctccgag       840
     gccgacctcc tggacatccg caacttcggt gcgaagtcca tcgacgaggt caaggcgaag       900
     ctggccggca tgggcctggg cctcaaggac agcccgcccg gattcgaccc gaccgccgcc       960
     gcactcggtg cggacgacga cgcggacgcg ggtttcctgg agacggagca ttactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page