(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0001

BA000037.VV0001      Location/Qualifiers
FT   CDS_pept        complement(353..787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0001"
FT                   /product="MioC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92765"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92765"
FT                   /db_xref="GOA:Q7MQK7"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK7"
FT                   /protein_id="BAC92765.1"
FT                   /translation="MIHIITGSTLGGAEYVGDHLSDLLQEAGFETTIHNHPQLNEIPNQ
FT                   GTWLIITSTHGAGEYPDNIQPFIHALQATPPKMSDVRYAVVAIGDSSYDTFCAAGLHAH
FT                   ALLTDIGASAITQCLTIDVLSHTVPEDAAEVWLKQHIEQF"
     atgattcaca tcatcacagg cagtacactc ggtggcgcag aatacgtggg cgatcacttg        60
     agtgacctac tgcaagaggc tgggtttgaa accaccattc acaatcaccc tcagttaaac       120
     gaaatcccta atcaaggcac ctggttgatc atcacctcta cgcatggcgc aggcgaatac       180
     ccagacaaca ttcagccttt tatccacgct ctgcaagcga ccccaccgaa aatgagtgat       240
     gttcgttatg ctgttgtggc gattggagac tccagttatg acaccttttg tgccgcgggt       300
     ctgcacgccc acgcgttact gactgacatt ggcgccagtg cgatcactca gtgcctgacc       360
     attgatgtgc tcagccatac cgtaccagaa gacgccgccg aagtttggct aaaacagcat       420
     atcgagcagt tttga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page