(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0003

BA000037.VV0003      Location/Qualifiers
FT   CDS_pept        complement(2314..3933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0003"
FT                   /product="inner membrane protein, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92767"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92767"
FT                   /db_xref="GOA:Q7MQK5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK5"
FT                   /protein_id="BAC92767.1"
FT                   /translation="MDSQRTLLVLLLALVSFLLFQQWQVAKNPAPQAVEQAQTSSTLPA
FT                   PSFADELDPAPAQQASAKLITVTTDVLTLSIDTVGGDVVAADLNQYSAELNSANAFELL
FT                   RDTQGHQFIAQSGLVGPQGIDLSSNNRPSYQVSADSFTLADDQNELRIPMTYQANGLEY
FT                   TKTFILKRGSYAIDVEFDVINKSGNNATLGMYAHLRQNLMDAGGSITMPTYRGGAYSTE
FT                   DTRYKKYSFEDMQDRNLSLTLTNGQGWAAMIQHYFAAAWIPRNEPGANLYTRVIGNMGD
FT                   IGVRMPNKTVADGDSAHFTATLWAGPKLQDQMAEVAPNLDLVVDYGWLWFIAKPLHWLL
FT                   SVIQSFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQR
FT                   MSQEMMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFILWIHDLSAQD
FT                   PYFILPLLMGGSMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSN
FT                   IVTLIQQSLIYKALEKKGLHTK"
     atggattctc aacgtactct cctggtcctg cttctggcgc tggtttcttt cttgctgttc        60
     caacagtggc aagtcgcaaa gaacccagcc cctcaagccg ttgaacaggc tcaaacaagc       120
     agcactttac ctgcaccatc ttttgctgat gaactggacc cagcgccagc gcaacaagcg       180
     tcagcaaaac tcatcacggt aacaacggat gtgttgactc tgtcaatcga cactgttggt       240
     ggtgatgtag tggctgcgga tttgaaccaa tattctgcag aactcaattc tgcgaatgcc       300
     ttcgagcttc ttagagacac tcaaggtcat caattcatcg cacaaagtgg tctggttggc       360
     ccacaaggca tcgacctaag cagcaacaat cgtccaagct accaagtgag cgcggacagc       420
     tttacgttag ctgacgatca aaacgaatta cgtattccaa tgacctacca agcgaatggc       480
     ttggagtaca ccaaaacctt tatcctaaaa cgtggtagct acgcgattga cgttgagttc       540
     gatgtcatca acaaatcagg taacaacgca acgttaggca tgtacgcaca cctacgtcaa       600
     aatctgatgg acgcgggcgg cagcatcacc atgccaacct accgtggtgg tgcttactca       660
     accgaagata ctcgttataa aaaatacagc ttcgaagata tgcaagatcg caatctgtct       720
     cttactctga ccaatggtca aggttgggca gcaatgatcc agcactactt cgctgcggcg       780
     tggatcccac gtaacgaacc aggtgcaaac ctgtacactc gcgtgattgg caatatgggt       840
     gacattggcg ttcgtatgcc aaacaaaacg gttgctgatg gcgatagtgc acacttcacc       900
     gcaacccttt gggctggtcc taaactgcaa gaccaaatgg cggaagtcgc accaaacctt       960
     gacttggttg ttgattacgg ctggttgtgg ttcatcgcga agccactgca ttggctactg      1020
     tctgttatcc aaagctttgt gggtaactgg ggtgtggcga tcatctgtct gaccttcatc      1080
     gtgcgtgggg caatgtaccc actgacgaaa gcgcaataca cctctatggc gaaaatgcgc      1140
     atgctacagc ctaaactgca agcaatgcgt gagcgcatcg gtgatgaccg tcagcgcatg      1200
     agccaagaga tgatggaact gtacaaaaaa gagaaagtaa acccacttgg tggctgcctt      1260
     cctctcattc tacagatgcc tatcttcatc gcactgtact gggcattgat ggaatcggtt      1320
     gagctgcgtc actcgccgtt catcctatgg attcacgacc tttcagcaca ggacccatac      1380
     ttcatcctgc cgctattgat gggtggttca atgttcctaa ttcagaagat gagcccaacg      1440
     actgtgaccg atcctatgca gcagaagatc atgaccttta tgccggtgat gtttaccttc      1500
     ttcttcctat ggttcccatc aggtctggtt ctatactggc tagtatcgaa catcgttact      1560
     ctgatccagc agtctttgat ttacaaagca ctggagaaaa aaggcttaca cactaagtaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page