(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0007

BA000037.VV0007      Location/Qualifiers
FT   CDS_pept        complement(5632..6342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0007"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92771"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92771"
FT                   /db_xref="GOA:Q7MQK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK1"
FT                   /protein_id="BAC92771.1"
FT                   /translation="MRFHLLFSLRVTGMGFDFNYMLELLPILLKYLGTTMEMAILGLVF
FT                   SLVLAVILANIRVFRVPILDPLSQLYISFFRGTPLLVQLFLLYYGLPQIFPIMVGLDAF
FT                   SAAVIGLTLHFAAYMAESIRAAIIGIDRSQMEASLSVGMTTSQAMRRVILPQATRVALP
FT                   SLMNYFIDMIKSTSLAFTLGVAEIMAKAQMEASSSFRFFEAFLAVALIYWGVVLVLTRV
FT                   QIWAENKLNKAYAR"
     ttgcgattcc accttttgtt ttctttaagg gtaactggta tgggatttga ttttaactac        60
     atgctagagc tactgccgat tctgctcaaa tacctcggca ccaccatgga aatggcgatt       120
     ctgggtttgg ttttctcttt ggtcttggcg gtaatactgg ccaatattcg tgtgttccgc       180
     gtccccatcc tcgatccact cagccaactc tacatcagtt ttttccgtgg cactccgctg       240
     ctggtacaac tgttcttgct ttactatggc ttacctcaga tcttcccaat catggttgga       300
     ctcgacgcgt tcagtgccgc tgttatcggt ttaacactgc attttgctgc ctacatggca       360
     gaaagcattc gcgccgcgat tattggcatt gaccgtagcc agatggaagc cagcttatcg       420
     gtaggcatga ccacctctca agcaatgcgt cgcgttatct tgccacaagc cactcgcgtc       480
     gctttgccat cattaatgaa ctactttatc gacatgatca aatccacctc gttagctttt       540
     acgctcggcg tggcggaaat catggctaaa gcgcaaatgg aagcctcgtc gagcttccgc       600
     ttctttgaag cctttttggc cgtcgcactc atctattggg gtgtcgtact ggtgctaacc       660
     cgagtacaaa tttgggccga gaacaaactg aataaggcgt atgcgagatg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page