(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0009

BA000037.VV0009      Location/Qualifiers
FT   CDS_pept        complement(6385..7137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0009"
FT                   /product="ABC-type amino acid transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92772"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92772"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK0"
FT                   /protein_id="BAC92772.1"
FT                   /translation="MNNWIKASIAAIALSAATFQAVAEEVVKVGMSGRYFPFTFVKQDQ
FT                   LQGFEVDMWDEIGKRNGYKVEYVTANFSGLFGLLETGRIDTISNQITMTDARKAKYLFA
FT                   DPYVVDGAQITVRKGNDSIKGVADLAGKTVAVNLGSNFEQLLRDYDKDGKINIKTYDTG
FT                   IEHDVALGRADAFVMDRLSALELIKKTGLPLQLAGEPFETIANAWPFVNNERGVKLQGE
FT                   VNKALAEMRADGTVEQISIKWFGADITK"
     atgaataact ggattaaagc gagtattgct gccatcgcgc tttctgcagc aacttttcag        60
     gcggttgccg aagaagtggt taaagtgggt atgtctggcc gctacttccc atttaccttt       120
     gtaaagcaag accaactgca aggttttgaa gtagatatgt gggatgagat tggtaagcgt       180
     aatggctaca aagtcgaata cgtaaccgca aacttctcag gtctgtttgg cttacttgaa       240
     acgggtcgca tcgataccat ttccaaccaa atcaccatga cggatgctcg caaagccaaa       300
     tacctttttg ctgaccctta tgtggtagac ggcgctcaga tcaccgtacg caagggcaat       360
     gacagcatca aaggcgttgc agaccttgca ggtaaaaccg ttgcggtcaa cctaggctca       420
     aactttgagc aactgctacg cgattacgat aaagacggca aaatcaatat caagacttac       480
     gataccggca ttgaacatga tgttgcgtta ggacgtgccg atgcattcgt gatggatcgc       540
     ctgtcagcac tagaactgat caagaaaacc ggtttgccac tacaattggc aggtgaaccg       600
     tttgaaacca tcgctaacgc atggccattt gtgaacaacg aacgtggcgt gaagctgcaa       660
     ggtgaagtca acaaagccct tgctgagatg cgcgcagacg gtacggttga gcaaatctca       720
     atcaaatggt ttggtgcaga catcaccaaa taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page