(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0010

BA000037.VV0010      Location/Qualifiers
FT   CDS_pept        7282..7404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92774"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92774"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ8"
FT                   /protein_id="BAC92774.1"
FT                   /translation="MGNHWARCIDPQKSSEIIVNNLDLIHWIVDQSLAILVINR"
     gtgggtaatc attgggcaag atgtattgat ccgcaaaaat caagcgaaat tattgtgaat        60
     aacttggatc ttattcactg gatcgttgat caatcgctgg cgatcttggt tatcaacagg       120
     taa                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page