(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0014

BA000037.VV0014      Location/Qualifiers
FT   CDS_pept        11125..13542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0014"
FT                   /product="DNA gyrase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92778"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92778"
FT                   /db_xref="GOA:Q7MQJ4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ4"
FT                   /protein_id="BAC92778.1"
FT                   /translation="MSNNYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEENVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKVLLTIHRGGHTHSQTYRHGVPDAPLAIIGDTEKT
FT                   GTTVRFWPSAETFTNIEFHYDILAKRLRELSFLNSGVSIKLFDEREEDKKDHFMYEGGI
FT                   QAFVTHLNRNKTPIHEKVFHFNAEREDGIAVEVAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNSYMDKEGYSKKAKTATSGDDAREGLTAVVSVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVESFMADKLNDFLAEHPSEAKTVCSKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPELIERGYVYIAQPPLYKVKKGKQEQYIKDEDAMNQYQISLALDNAALHVNPDAPAL
FT                   AGEALEKLVQQYNAAIKLVDRMSRRYPRALIHELIYVPRLSETQFADQAAMAAWTEQLV
FT                   TQLNAKEVGASQYSFEIEHDAERGLFSPKIVVRTHGVMHEYPLSVDLINSKEYQKLAEL
FT                   ADALDGLIEEGAYIQRGERTQPVNSFASALEWLIKESRRGLSLQRYKGLGEMNPDQLWE
FT                   TTMDPETRRMMRVTIEDAVGADELFTTLMGDQVEPRRNFIEENALKVANLDV"
     atgtcgaaca attacgattc atcgagtatt aaggtactga agggtctgga tgcggtacgt        60
     aagcgtccgg gtatgtacat cggggacaca gatgatggca ccggtctgca ccacatggtt       120
     tttgaggtgg tggataactc aattgatgaa gccttagcag gccactgtaa agatatcgta       180
     gtcacgattc atgaggataa ctcagtttct gttagcgatg atggccgtgg tatcccgacc       240
     gaaatgcacc cagaagagaa cgtgtctgct gccgaagtta tcatgacggt actgcacgct       300
     ggtggtaagt ttgacgacaa ctcttacaaa gtgtctggcg gtcttcacgg tgtaggtgtt       360
     tcggtggtaa acgcactgtc tgaaaaagtg ctgttgacga ttcatcgtgg tggtcatacc       420
     cacagccaaa cctatcgtca tggtgtgcct gatgcaccgc ttgctatcat cggcgatacc       480
     gaaaaaaccg gtaccacggt acgtttctgg ccaagtgctg aaaccttcac caacatcgaa       540
     tttcattatg acatcctagc gaagcgtcta cgtgagctct ctttcctgaa ctctggcgtg       600
     tcgatcaaac tgtttgatga gcgcgaagaa gataagaaag atcacttcat gtatgaaggt       660
     ggtattcaag cgttcgtcac tcacttgaac cgcaacaaaa cccccatcca tgaaaaagta       720
     ttccatttta atgccgagcg tgaagacggt attgcggttg aagtggcgat gcagtggaac       780
     gatggtttcc aagaaaacat ctactgtttt accaacaaca tcccacagcg tgacggtggt       840
     acccacttag cgggtttccg cgcggcattg acgcgcacac tgaacagcta catggacaaa       900
     gaaggctact cgaagaaagc gaaaaccgcg acttctggtg acgatgcgcg tgaaggtttg       960
     accgctgttg tttcagttaa agtgccggat ccaaaattct caagccaaac caaagacaaa      1020
     ctggtttcta gtgaagtgaa gtccgcagtg gaatccttca tggcagacaa actgaacgac      1080
     ttcttggccg aacacccaag cgaagcgaaa accgtttgtt ctaagattat cgacgccgca      1140
     cgtgcgcgtg aagctgcacg taaagcgcgt gaaatgacac gccgtaaagg ggcgttagac      1200
     cttgctggcc ttcctggtaa acttgctgac tgtcaggaaa aagatcctgc actgtctgaa      1260
     ctttacatag tggagggtga ttcggcaggc ggctccgcaa aacaaggccg taaccgtaag      1320
     aaccaagcaa tcctaccgct aaaaggtaag attctaaacg tagaaaaagc gcgtttcgac      1380
     aagatgctct cttctcaaga agttgcaacg ctgatcaccg cactaggttg tggtatcggt      1440
     cgtgacgagt acaacccaga caaactgcgt taccacaaca tcatcatcat gaccgatgcc      1500
     gacgtcgatg gttcgcacat ccgtacgcta ctgttgacct tcttctaccg tcaaatgccg      1560
     gagcttattg agcgtggtta cgtgtatatc gctcagccac cactgtacaa agtgaagaaa      1620
     ggcaaacaag agcagtacat taaagatgaa gatgcgatga accagtacca aatttccttg      1680
     gcattggata acgcagcgct gcacgtgaac ccagacgcac cagcattggc tggtgaagca      1740
     ctagagaaac tggttcaaca atacaatgca gcgattaagc tggtggatcg catgagccgt      1800
     cgttacccac gtgcactgat tcatgaactg atttatgttc cgcgtctcag cgaaacacaa      1860
     tttgccgatc aagcagcaat ggcagcatgg acagagcaac tggttactca gttgaacgcc      1920
     aaagaagtgg gcgcaagcca atacagtttt gaaatcgaac acgatgcaga gcgcggactg      1980
     ttctcaccga agattgtggt tcgtacccac ggtgtgatgc acgagtaccc actgagcgtg      2040
     gatctgatca actcgaaaga ataccagaag ctggcagagc tggcggatgc gctggacggt      2100
     ttgatcgaag aaggtgcgta tattcagcgt ggtgaacgta ctcaacccgt gaacagtttt      2160
     gcaagtgcgc ttgagtggct gattaaggaa tctcgtcgtg gtttgagcct acaacgctac      2220
     aaaggtttgg gtgagatgaa cccagatcag ctttgggaaa ccaccatgga tccagaaact      2280
     cgccgcatga tgcgcgtgac cattgaagac gccgttggtg cggatgagct gttcacgacc      2340
     ttgatgggtg atcaagttga accacgtcgt aacttcatcg aagaaaacgc attgaaagta      2400
     gcgaacctag acgtgtaa                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page