(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0020

BA000037.VV0020      Location/Qualifiers
FT   CDS_pept        complement(18651..20732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0020"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92784"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92784"
FT                   /db_xref="GOA:Q7MQI8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI8"
FT                   /protein_id="BAC92784.1"
FT                   /translation="MAKEFLIELGTEELPPTQLRTLAEAFAANFEAELKGAELTHEGVK
FT                   WYAAPRRLALKVTALAEHQADKIVEKRGPAVSAAFDAEGNATKAAQGWARGCGITVDQA
FT                   ERMITDKGEWLLFKQEVKGQPTADIVVELAAKALAGLPIAKPMRWGNKTTQFIRPVKTL
FT                   TMLMGSDLIQGEILGVASDRVIRGHRFMGEREFTIESAEQYPAILEERGKVMADYEMRK
FT                   AIILADAQKAAAAIGGIADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPAEALVYTMK
FT                   GDQKYFPVYTEDKQLLPNFIFVSNIESKEPRYVIEGNEKVVRPRLADAEFFFNTDRKSK
FT                   LIDRLPMLENAIFQQQLGTIKDKTDRITELAGYIAEQIGADVEKSKRAGLLAKCDLMTS
FT                   MVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYMPRFAGDDLPSNGVSAAVAMADKLD
FT                   TIVGIFGIGQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDLVAKAKSLFAQQDGTSR
FT                   LTNDNVEQEVIEFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDQRVKAVSHFREL
FT                   EAAEALAAANKRVGNILAKFDGELAAEIDLALLQEDAEKVLAENVEVMTEALEPAFATG
FT                   NYQEALSKLADLREPVDAFFDNVMVMADDEALKTNRLTLLNNLRNLFLQIADISLLQK"
     atggcaaaag aatttttaat cgagctaggt actgaagaac tgccaccaac gcaacttcgt        60
     actctggctg aagcatttgc agcaaacttt gaagcagagc taaaaggtgc tgaactaacg       120
     cacgaaggtg tgaaatggta cgcagcgcct cgtcgccttg cactgaaagt caccgcatta       180
     gccgaacacc aagcagacaa aatcgttgaa aagcgtggtc ctgccgtttc tgccgctttt       240
     gatgcagaag gtaatgcaac caaagccgct cagggttggg cacgtggttg tggcatcacg       300
     gttgatcaag cagagcgcat gatcaccgac aaaggcgaat ggctgctgtt caaacaagaa       360
     gtcaaaggcc aaccaacggc tgatatcgtg gttgagctgg cagccaaagc gctagcaggt       420
     ctacctatcg caaaacctat gcgttggggt aacaaaacca ctcaatttat ccgtccagta       480
     aaaacgctga ctatgctaat gggtagtgac cttattcaag gtgaaatcct aggcgtagct       540
     tctgatcgcg ttatccgtgg tcaccgcttt atgggtgagc gcgagttcac tatcgagtct       600
     gcagagcaat acccagcgat cctcgaagag cgcggtaaag tgatggcaga ttacgaaatg       660
     cgtaaagcca tcattcttgc tgacgcacaa aaagcagcag cggcaatcgg cggtatcgct       720
     gatctcgaag atgacctagt cgaagaagtc acctctctgg ttgaatggcc agtggtactg       780
     accgctaagt tcgaagaaga gttcctaaaa gtcccagctg aagcattggt ttacaccatg       840
     aaaggtgacc aaaagtactt ccctgtctac accgaagaca agcagctact gcctaacttc       900
     atcttcgtgt ctaacatcga atcgaaagag cctcgttatg tgattgaagg taacgagaaa       960
     gtagttcgtc cacgtcttgc ggatgcggaa ttcttcttca acacggaccg taagagcaag      1020
     ctcatcgatc gtctgccaat gctagaaaac gcgattttcc aacagcaact tggcaccatt      1080
     aaagacaaaa ccgatcgcat cacggaactg gctggctaca ttgctgagca aatcggtgcg      1140
     gacgttgaaa aatcaaaacg cgcaggtcta cttgcaaaat gtgacctaat gacatcaatg      1200
     gtattcgaat ttaccgatac tcaaggtgtg atgggcatgc actacgctcg ccacgacggt      1260
     gaagcggaag aagtagcact ggcactaaac gagcaataca tgcctcgttt cgctggtgat      1320
     gacctaccat caaatggtgt gtcagcagca gttgcgatgg cagacaagct cgacactatc      1380
     gtcggtatct tcggtatcgg ccaagcgcca aaaggttctg acccatttgc actgcgccgc      1440
     gcatcactcg gtgtactgcg tatcatcgtt gaatacggtt acaacctaga ccttgttgac      1500
     ctagtagcga aagcgaaatc actgttcgct caacaagatg gtactagccg tttaactaac      1560
     gataacgttg agcaagaagt aattgagttt atgcttggtc gtttccgtgc atggtaccaa      1620
     gatgaaggtt tcagcgttga catcattcaa gcggtattgg cacgtcgtcc aacgaaacct      1680
     gctgactttg accaacgtgt taaagcggtt tctcacttcc gtgaactgga agcggcagaa      1740
     gcactggcgg cagcgaacaa acgtgtaggt aacatcctag cgaaattcga tggcgagcta      1800
     gcagcagaaa tcgaccttgc gctactgcaa gaagacgcag agaaagtact ggctgaaaac      1860
     gtggaagtga tgacagaagc gcttgagcca gcatttgcca ctggtaacta tcaagaagcg      1920
     ctaagcaaac tcgctgacct acgtgagcct gtggatgcgt tcttcgataa cgtaatggtt      1980
     atggctgatg atgaggcact gaagaccaac cgtctaacgc tcctgaacaa cctgcgtaac      2040
     ctgttcctac agatcgcaga catttctttg cttcaaaagt aa                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page