(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0022

BA000037.VV0022      Location/Qualifiers
FT   CDS_pept        22144..22698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0022"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92786"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92786"
FT                   /db_xref="GOA:Q7MQI6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI6"
FT                   /protein_id="BAC92786.1"
FT                   /translation="MSVLAISITTVALAEIGDKTQLLSLLLASRYRKPIPIIAAIFFAT
FT                   IANHALAAWLGVVVADYLSPDVLKWVVVASFLAMAGWVLIPDKLDDEEEISNRGPFVAS
FT                   FIAFFIAEIGDKTQIATSILGAQYADALTWVVLGTTIGMLLANAPVVLIGKLSADKLPL
FT                   ALIRKVTAALFVALAAGAALF"
     gtgagcgttt tagctatttc aattactact gtcgccttgg ccgaaattgg cgataaaacc        60
     caattgttgt ctctgctgtt agccagccgt taccgcaaac caatcccaat cattgctgcg       120
     atctttttcg cgacgattgc taaccatgcc cttgcagcct ggctgggtgt ggtggtggcc       180
     gattatcttt ctcccgacgt gttgaagtgg gtggtggtgg ccagtttctt agccatggcg       240
     ggatgggtgt tgattcccga taagttggat gacgaagaag agatctcaaa ccgtggccct       300
     tttgtggcca gctttattgc tttctttatc gctgagattg gcgataaaac gcagatcgca       360
     acgtccattc tcggggctca gtatgcggat gcactgactt gggtcgtgtt aggaaccacc       420
     attggcatgt tgctggccaa tgcccctgtg gtgctgattg ggaaactgtc agcagataaa       480
     ctgccactgg cgttaatccg caaagtcaca gcggctctgt ttgtcgcgtt agcggccggt       540
     gcagctttat tttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page