(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0023

BA000037.VV0023      Location/Qualifiers
FT   CDS_pept        22858..23118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0023"
FT                   /product="NADH dehydrogenase subunit II-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92787"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92787"
FT                   /db_xref="GOA:Q7MQI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI5"
FT                   /protein_id="BAC92787.1"
FT                   /translation="MLTRYMGMTPKSQSYLFTFGLALCLLAMVLTDMWLPIVAGSFILT
FT                   GLTVEAWIRVAHIIPMHEEMRSMKKQLNKLQSEIRTIEFDQ"
     atgcttacac gttacatggg gatgacccca aaaagtcaga gttatttatt cacttttggt        60
     ttggcgctct gtttgttggc aatggtttta acagatatgt ggctaccaat tgtggcggga       120
     tcctttattt tgacaggatt gactgttgaa gcgtggattc gagtcgcaca catcattcca       180
     atgcatgaag agatgcgatc gatgaaaaag cagttgaata aactgcaatc ggaaattcgc       240
     actatcgaat tcgatcaata a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page