(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0024

BA000037.VV0024      Location/Qualifiers
FT   CDS_pept        complement(23158..23403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0024"
FT                   /product="predicted redox protein"
FT                   /note="identified by Glimmer2"
FT                   /note="regulator of disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92788"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92788"
FT                   /db_xref="GOA:Q7MQI4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI4"
FT                   /protein_id="BAC92788.1"
FT                   /translation="MSFNPELATKTLEAEGLRCPEPVMMVRKTIRTMQDGEVLLVKADD
FT                   PSTTRDIPSFCRFMDHQLIAAQTDELPYQYLIKKGL"
     atgagcttta atcctgaact ggcgaccaag accttagagg cggaaggact acgctgccca        60
     gagccagtaa tgatggtcag gaagacaatt cgaaccatgc aagacggtga ggttttactg       120
     gtaaaagcgg atgatccatc caccaccaga gacattccaa gcttttgtcg ctttatggat       180
     caccaactca ttgcggcaca aaccgacgag ctaccctatc agtatctgat taaaaaaggc       240
     ttataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page