(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0042

BA000037.VV0042      Location/Qualifiers
FT   CDS_pept        complement(50663..50839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92806"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92806"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG6"
FT                   /protein_id="BAC92806.1"
FT                   /translation="MIIQQTNESLLIAEYYSKNQVGTQFGKKHTKKQQLKFNGQQSVNF
FT                   KAKISNKYSLIDI"
     atgatcattc aacaaaccaa tgaatccctt ctgattgcag aatattactc taaaaatcag        60
     gtcggaacac aatttggcaa aaaacacaca aaaaagcaac aattaaagtt taacggccag       120
     caatctgtta atttcaaggc aaaaatatcg aataaatatt cgttaataga tatttaa          177
//

If you have problems or comments...

PBIL Back to PBIL home page