(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0043

BA000037.VV0043      Location/Qualifiers
FT   CDS_pept        50886..52601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0043"
FT                   /product="Peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92807"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92807"
FT                   /db_xref="GOA:Q7MQG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG5"
FT                   /protein_id="BAC92807.1"
FT                   /translation="MSLLEVKNLRIEYPSRHGIHAAVKSLSFNIERGEIVGVVGESGAG
FT                   KSTVGNAVSDLLSPPGRIASGDVFLDGEKISGLSPEAMRKVRGSKIGFIFQDPMTSLNP
FT                   LFTVEQQLKETIHANMNVSDEEAYTRALSLMKQVGIPQPENRLKQYPHQFSGGMRQRVV
FT                   IAIALAGEPDLIIADEPTTALDVSIQDQILNLIRELCIKHNVGCMLVTHDMGVVSNVTD
FT                   RVAVMYRGDLVEFGPTAKVLGNPDHPYTRSLISAVPRSDRKLDRFPLVSYIEEASELQP
FT                   LDIKNHWLGQSEDQRKYTGPLLNVENVNLRFVTKDSLFESRREYVQASNNVSFQVHEGE
FT                   TFGLVGESGSGKSTIARVIAGLYAPNSGKVTFEGIDLTALTSEKARRPLRRQMQMVFQN
FT                   PYTSMNPRMKIFDIIAEPIRFHKLTNSEAETRQIVNDLLEHVGLGRMAGVKYPHEFSGG
FT                   QRQRISIARALATRPRLLICDEPTSALDVSVQAQILNLLKDLQSELNLTMLFISHDLPV
FT                   IRQMCDRVGVMQMGTLLEVAPTEQLFRSPQHEYSKHLISLMPEFTGLREEVKTA"
     atgtcactat tagaagtgaa aaatcttcgt atcgagtatc catcgcggca tggtattcat        60
     gcggcggtga aatcgttgtc gtttaatatt gaacgaggcg aaattgttgg cgtcgtcggt       120
     gagtcgggtg cgggcaagtc aaccgtaggt aatgcggtga gcgatttgtt gagccctcct       180
     ggtcgtattg ccagcggtga tgtgttcctt gatggcgaaa aaatttcagg cctttctcca       240
     gaagcaatgc gcaaagtgcg tggctctaaa attggtttta tcttccaaga tccaatgacc       300
     tcgctcaatc ctctctttac tgttgaacag cagttaaaag aaaccattca cgccaatatg       360
     aatgtctctg acgaagaggc ttacacgcgc gcattgtcat taatgaagca ggtgggcatc       420
     cctcaacctg aaaaccgctt aaagcagtat cctcaccagt tttctggcgg tatgcgtcag       480
     cgcgtggtga ttgcgattgc cctagcaggc gagccggatt tgatcattgc cgatgaaccc       540
     accacggcac tcgatgtgtc gattcaagac caaatcctca acctgatccg cgagctatgc       600
     attaagcaca acgtgggttg catgttggtc acgcacgaca tgggcgtggt atcgaacgtg       660
     actgatcgtg ttgctgttat gtaccgaggt gacttggttg aatttggccc aacggccaaa       720
     gtgttgggca acccagatca tccttatacg cgcagcttga tttcagcggt gccgcgttcg       780
     gataggaagc ttgatcgctt ccctctggtc agttacatcg aagaagcgag cgaattgcag       840
     cctcttgata ttaagaatca ctggctgggt caaagtgaag atcagagaaa atacaccggg       900
     ccgctgctta atgtggaaaa cgttaacttg cgtttcgtca ctaaggactc gctgtttgag       960
     agccgtcgtg agtatgtgca ggcatcaaat aacgttagct tccaagtgca tgaaggggaa      1020
     acctttggct tggtggggga atcgggttcg ggtaaatcca ctattgcacg agtcattgcc      1080
     gggctgtatg cgcctaactc aggtaaggtg acgtttgaag gtattgacct taccgcattg      1140
     acctcagaaa aagcgcgccg tcctttgcgt cgccaaatgc agatggtctt ccaaaatcca      1200
     tacacttcga tgaacccgcg catgaagata ttcgacatca tcgcggagcc cattcgtttc      1260
     cataagttga ccaacagtga agcggaaacg cgccaaatcg tgaacgatct cttggagcac      1320
     gttggcttag ggcgaatggc cggggtgaaa tatccacatg aattttcggg tggtcagcgt      1380
     cagcgtattt cgattgcgcg cgcattagcg actcgtccac gtcttttaat ttgtgatgag      1440
     ccaacctcgg cactggatgt ctcggttcaa gcacagattc tgaatttgct caaagatcta      1500
     caaagcgaac tgaacttaac catgctgttt atcagtcatg accttccggt tatccgccaa      1560
     atgtgtgacc gagtcggtgt gatgcagatg ggaaccctgc tcgaagtcgc accgactgag      1620
     caactgttcc gctctccaca gcatgaatac agtaagcacc tgatttcctt gatgccagag      1680
     ttcactggtt tgagggaaga ggtgaaaacg gcataa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page