(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0044

BA000037.VV0044      Location/Qualifiers
FT   CDS_pept        52677..54233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0044"
FT                   /product="Peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92808"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92808"
FT                   /db_xref="GOA:Q7MQG4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG4"
FT                   /protein_id="BAC92808.1"
FT                   /translation="MKTMKSKLTVALMAAGLSLSAAAADIKVAYDADPVSLDPHEQLSG
FT                   GTLQMSHMVFDPLVRYTQKLDFEPRLAEKWERVNDTTYRFQLRKGVKFHSGNELTADDV
FT                   VWTFDRLKDSPDFKAIFEPYEKMVKVDDYTVELVSKGAYPLVLQTATYIFPMDSKFYSG
FT                   TTADGKDKAEVVKHGNSFASTNVSGTGPFIVTSREQGVKVEFERFKDYWDKESKGNVDK
FT                   LTLVPIKEDATRVAALLSGGVDMIAPVAPNDHQRVKDAKGIDLVTLPGTRIITFQMNQN
FT                   SNEALKDVRVRQAIVHAINNQGIVDKIMKGFATAAGQQGPEGYAGYNAELVPRFDLKKA
FT                   KQLMKEAGYEKGFTLTMIAPNNRYVNDAKVAQAASAMLSKIGIKVDLKTMPKAQYWPEF
FT                   DKCAADMLMIGWHSDTEDSANFSEFLTMTRNEETGRGQYNCGHYSNPEVDKLVEAANVE
FT                   TDPAKRAAMLQKVETTLYNEAAFVPLHWQNLAWGAKSTLDIKPIVNAMDFPYFGDLVVK
FT                   E"
     atgaaaacca tgaaaagcaa actgaccgtg gctttaatgg ctgcaggcct aagcctgagt        60
     gctgctgcgg cagacatcaa agttgcttat gatgcagatc cagtgtcact tgacccgcat       120
     gagcagttgt ctggtggtac gctacaaatg tcgcacatgg tgtttgatcc actagttcgt       180
     tatacccaga aattggattt tgaacctcgc ttggctgaaa aatgggaacg tgtcaatgac       240
     accacttacc gcttccagct acgtaaaggg gtgaagttcc attccggtaa cgaactgacg       300
     gcagatgatg tcgtgtggac attcgatcgt ctgaaagatt ctccagactt taaagcgatc       360
     tttgaaccgt atgaaaaaat ggtcaaagtg gacgattaca ccgttgagtt ggtgtccaaa       420
     ggggcttacc cattggtgct acaaaccgcc acttacatct tcccgatgga cagcaagttc       480
     tactctggca cgacagccga tggcaaagac aaagcggaag tggtgaagca cggtaactca       540
     tttgcttcga ccaacgtttc tggtacgggt ccgttcatcg tcacttctcg tgagcaaggc       600
     gtgaaagtag agtttgagcg ctttaaagat tactgggaca aagagtcaaa aggtaacgtt       660
     gataagctga cgcttgtgcc aatcaaagaa gacgcgactc gtgtcgctgc gctcctttct       720
     ggtggtgttg acatgattgc gccagtggca cctaacgatc accaacgcgt gaaagatgcg       780
     aagggcatcg atcttgtgac gctgcctggt acgcgtatca tcactttcca aatgaaccaa       840
     aacagcaacg aagcgctgaa agatgtgcgc gtgcgtcagg cgatcgttca tgccatcaac       900
     aatcaaggta tcgttgataa gatcatgaaa ggtttcgcga cagcggctgg ccagcagggc       960
     cctgaaggct acgcgggcta caacgcggag ctggttcctc gtttcgatct gaaaaaagcg      1020
     aagcagttga tgaaagaagc gggttatgag aaaggcttta cgctgacgat gatcgcgccg      1080
     aacaaccgtt acgttaacga tgcgaaagtg gctcaagcgg cgtctgccat gctatcgaaa      1140
     atcggtatca aggtagacct aaagaccatg cctaaagcgc aatactggcc tgagtttgat      1200
     aagtgtgcag cagacatgtt gatgatcggc tggcactcag acacagaaga ttcggcgaac      1260
     ttctctgagt tcctcaccat gacgcgtaac gaagaaacgg gccgtggtca gtacaactgt      1320
     ggtcactact caaacccaga agtggacaag ttggtggaag cggcgaacgt agaaaccgat      1380
     cctgctaaac gtgcagcgat gctacagaaa gtcgaaacca cgctgtacaa cgaagcagca      1440
     ttcgttcctc tacactggca aaacctagcg tggggcgcga aatctacgct ggatatcaaa      1500
     ccaattgtca acgcgatgga cttcccatac tttggtgact tggtagttaa agagtaa         1557
//

If you have problems or comments...

PBIL Back to PBIL home page