(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0048

BA000037.VV0048      Location/Qualifiers
FT   CDS_pept        56490..57434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92812"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92812"
FT                   /db_xref="GOA:Q7MQG0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG0"
FT                   /protein_id="BAC92812.1"
FT                   /translation="MELSKSARLPIFKPQRLWLMAALCFFGVATPAAAEGFLCEATQAS
FT                   TNELPMLDKACPIGDGVWGKKAPKSGKEDFFWIQCGILNQPMPLADAKPLYKQITTDVW
FT                   MKPENKTYRCLIGPYQSFAQASKDLKQVKKLGDYREAFIRVVKPHSAVKPVTASKEQKA
FT                   ITKPTAPKAQPKAPAAANKPMAAPAQATLATTPAKRSNDDSSSIDIRKSAELKGRTYAV
FT                   PYLMDDEHQFYMEHNQAWNRLDYGSAEVVCGDLHMRLLTEEEFFTLLDSKVMENQQWPM
FT                   QLPYWGRGKKGFFTDGRVTQVKGSSLLNVLCVK"
     atggaactaa gcaaatcggc acgcttgccg atcttcaaac ctcaacgatt gtggttgatg        60
     gcggcactgt gtttctttgg tgttgctact ccagcagcgg cggagggctt tttatgtgaa       120
     gccacacagg caagcaccaa cgaattaccc atgttagata aagcctgccc tattggtgat       180
     ggtgtttggg gtaaaaaagc gcccaaaagc ggcaaagagg atttcttttg gattcaatgc       240
     ggtattttaa atcagccaat gccactggcc gacgccaaac cgctttacaa gcagatcacc       300
     accgatgtgt ggatgaaacc tgaaaacaaa acctatcgtt gtttgattgg cccgtatcaa       360
     tcttttgctc aagcgagcaa agatcttaaa caggtcaaaa aactgggcga ttaccgagaa       420
     gcctttattc gagtcgttaa gccacattct gcggtaaaac cggtcacagc aagcaaagaa       480
     cagaaagcga taaccaagcc caccgcccca aaagcacaac cgaaagcgcc ggctgcggcc       540
     aacaagccaa tggcagctcc tgcacaggcg accttggcca caacgccagc taagcgtagt       600
     aacgatgact catcatcgat cgatattcgt aaaagtgccg agttaaaagg tcgtacttat       660
     gcagtgcctt atttgatgga tgatgagcac cagttttata tggaacacaa ccaagcatgg       720
     aatcgcttgg attacggcag tgcggaagtg gtgtgcggcg atttgcacat gcgtttgtta       780
     actgaagagg aattttttac cctgctggat tcaaaagtga tggaaaacca gcagtggcca       840
     atgcaattgc cctattgggg aagaggaaaa aaaggcttct ttaccgatgg ccgtgtgacg       900
     caggtaaaag gctcttcgct gttgaatgtg ctgtgtgtga agtag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page