(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0049

BA000037.VV0049      Location/Qualifiers
FT   CDS_pept        complement(57492..60218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92813"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92813"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF9"
FT                   /protein_id="BAC92813.1"
FT                   /translation="MKKVSLLAASVAIALTGCGGSDSGSGSNGNVAPGGIIVTGFDGYF
FT                   NQAVVFLDKDNNGKLDIGSDTIFGLTDKEGRRTIPAGTQGVLALQTLTPGGTVQTALTQ
FT                   YDADTYAGKYTIDMDHPTQAMAHEVVLRTLPGEKIISPLTDLVVVQAGANPTKEKIEEA
FT                   KAEVNETLGITGNIAFTDVIAAKNHALHKTAQILTESKVNAGVNYTAENAMKIAQEANK
FT                   IVTAPENQDKLDQPNFKPTVEVTPSGDVQVTVNNKLIVNKSVADNIRAQLNTPSTSHSL
FT                   DLTLDLAVGQDALFSDSDNNNIALDVQVIDPIDNQAVSGLIITANNGGSLTIKGELTPV
FT                   RQSYILQITGTDIDAEAAVVGKVSTLFTLTVETPNSAPTIVPKIAEDLQAWIGSIELTQ
FT                   GVAVTNEQYRIDNLFADADGDELIIDASSTIKELELSVIAVGGTKELKIAGTPTNTYPA
FT                   GETITISAFDGIERTSKSFVLKQVDAKPIASFEVNTNALANLQSEITSQLVDLKVNEPL
FT                   PSVQLSITLDDIFKAVNAHGPVEYFAGMKGENQDHNTSVAGIKVAVDNMGVLTISGTPL
FT                   EASTNGEFYIAAGIYPDAEDGVISEMKRIALPEVKAADTPPPVSLGFTKQHFNNQQWVM
FT                   GSFADRDGEIGYASLLNTNGTFEWCWGDQEREGYQVFKSNISDSNGAPDPINTLSTLNK
FT                   VSGYLESTNKDCWPVTLNNDGTLTAHHSDEGVDTNWNYEMLYQNSNNGHYQIIVKINNQ
FT                   ELFWLDSASTPLDQTLAVNTQIAEGKVEYYMSVEGDGQYHPELDGPKLSYSYGKREYQA
FT                   NNQYQDNSILPEGFDTPGIWQSVKDMDGLERAELEEEREDQKTRVRYVHRDFGDFYIGI
FT                   TWSKEVNGYESPAQYSLFSHNQEAMDKLVKAMPLMTN"
     atgaaaaagg ttagtttact agcagcgtca gtggcgatcg ccctcaccgg ttgtggcggt        60
     tcagacagtg gttcaggttc taatggcaac gtcgcacctg gcggcattat cgtgacaggc       120
     tttgacggtt actttaatca agccgtggtg tttcttgata aagacaacaa cggcaagctc       180
     gatatcggca gcgataccat tttcggtcta acggataaag aaggccgtcg aacaatccca       240
     gcaggaacac aaggtgtgct ggcactgcaa acgctcactc cgggcggcac cgttcaaact       300
     gctctaaccc agtatgacgc cgacacttat gccggcaaat acaccatcga tatggatcat       360
     ccaactcaag cgatggcgca tgaggtggtt cttcgtactc taccgggtga aaaaatcatt       420
     tctcctctca ctgaccttgt tgtcgttcaa gcaggcgcaa acccaacaaa ggaaaagatt       480
     gaagaagcca aagcagaagt taacgagacg ctaggcatca cagggaatat cgcgtttacc       540
     gatgttatcg ccgcgaaaaa ccatgctttg cataagaccg ctcagattct cacagagtcc       600
     aaagtcaatg caggcgtgaa ctacaccgct gaaaacgcaa tgaaaattgc tcaagaagcc       660
     aataaaattg ttacagcacc tgaaaaccaa gataagttag accagccaaa ctttaagcca       720
     accgttgaag ttactccgtc aggggatgtg caagtcaccg tcaacaacaa gctaatagtg       780
     aataagagtg ttgccgacaa catcagagcg cagttgaaca caccaagcac gtcacacagc       840
     ttggatctca ctttagatct ggcagttggc caagatgcat tgttctctga tagtgacaac       900
     aacaacattg cactagacgt gcaagtgatc gacccgatcg acaaccaagc cgttagtggt       960
     ctaatcatca cggctaacaa tggtggctca ctgaccatca aaggtgaact cacccctgtc      1020
     cgccaatcct atattttgca aatcactggt acagatatcg atgcagaagc ggcagttgtc      1080
     ggtaaggtat ctaccctctt tacgctgaca gttgaaacac caaacagcgc gccaactatc      1140
     gtccctaaaa tcgccgaaga cctgcaagct tggattggca gtatcgaact aactcaaggc      1200
     gtggcggtga cgaatgaaca ataccgtatc gacaacctgt tcgccgatgc agatggtgat      1260
     gaacttatca ttgatgcaag ttcaaccatc aaggaactag aactgtcggt catcgctgta      1320
     ggcggcacta aagaactgaa aattgcggga acgccaacga atacttaccc cgccggtgaa      1380
     accatcacca ttagcgcatt cgatggtatt gaacgtactt caaagagctt tgtgttaaag      1440
     caggtggatg cgaaacctat cgcaagtttt gaagtgaaca caaacgcctt agcaaaccta      1500
     caaagcgaaa tcacatcaca gcttgttgac ctaaaagtga atgaaccgct gccaagcgtg      1560
     cagctcagca tcacactgga tgatattttt aaagccgtta acgctcatgg tcctgttgag      1620
     tacttcgctg gtatgaaagg ggaaaatcaa gatcacaata ccagtgttgc gggtattaag      1680
     gtcgcagttg acaacatggg tgttctaacc atctcgggta cgcctctaga agcaagcacc      1740
     aacggtgagt tttatattgc tgctgggatc tacccagatg cggaagatgg tgttatttca      1800
     gaaatgaaac gcattgcact tcctgaagtc aaagccgctg acactcctcc tccagtttct      1860
     ttaggattta ccaagcaaca ctttaacaat cagcaatggg ttatgggcag ctttgccgat      1920
     cgtgacggag aaattggtta cgcctcacta ctcaatacca acggtacatt tgaatggtgc      1980
     tggggcgatc aagaaagaga aggttatcaa gtcttcaaat ctaacatcag tgattccaac      2040
     ggtgcgccag atcctatcaa cacacttagc acgcttaaca aggtctctgg atatttggaa      2100
     agcaccaata aagattgctg gccagtaaca ctcaataatg acggcacatt gacagcgcat      2160
     cacagtgatg agggagttga cactaactgg aactacgaaa tgctgtacca aaacagcaac      2220
     aatggtcact atcaaattat tgtgaaaatc aacaatcagg agctgttctg gctcgattcg      2280
     gcatcaacac cacttgacca aaccctagcg gtgaacacac aaatcgctga aggcaaagtc      2340
     gagtactaca tgtcggtgga aggtgatggt cagtatcacc cggaactgga tggcccgaaa      2400
     ctgagttact cgtacggcaa acgagagtac caagctaata accaatatca agacaactca      2460
     attctgccag aaggctttga cacacctgga atatggcaaa gcgttaaaga catggacggc      2520
     ttggaaagag cagaactaga agaagaacgt gaagatcaga aaacgcgtgt tcgatatgtc      2580
     caccgtgact ttggtgactt ttacatcggc attacatgga gtaaagaagt caatggttat      2640
     gaatcgccag ctcaatactc gctcttcagc cacaaccaag aagccatgga taaactggtt      2700
     aaagcaatgc ctttaatgac gaattag                                          2727
//

If you have problems or comments...

PBIL Back to PBIL home page