(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0050

BA000037.VV0050      Location/Qualifiers
FT   CDS_pept        60471..61334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92814"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92814"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF8"
FT                   /protein_id="BAC92814.1"
FT                   /translation="MKQWARLITIGACLGSASAGAQATLDKSKYGYSYFTLGFENVVYE
FT                   ELFPGLDSDASVVSPVLNTGGLYHINTRFDFSIDALATFSPMSATEEWQKDGTLIQTNQ
FT                   FEYLKAATNILLHYKLQDNWRVLGGTSLTYQTYKRYGLKNHNGYVNDVFREGNTWEEKS
FT                   TDIFLDAGVAYDSGHLYGESDWRVSGRWIFGVPIWSVTENSRFEDIQFNDFGFRTNAEA
FT                   TLSYQIMPGLHLGWFVMLGYEKRFESDPQRVMYTTASGVEKQGQAWLPEAQTWTLNTGL
FT                   QALWNF"
     atgaaacagt gggctaggtt aatcactatt ggcgcgtgtt taggctcagc atcggctggg        60
     gcgcaagcga cccttgataa gagtaaatat ggttactctt actttaccct tggctttgag       120
     aatgtggtgt atgaagagct gtttcccggc ttagactccg atgccagtgt ggtgagccct       180
     gtgctgaata ctggcgggct ttatcacatc aatacgcgct ttgatttttc cattgatgcg       240
     ttagcgacct tttcgccgat gagtgccacc gaagagtggc agaaagacgg tacgctgatt       300
     caaaccaacc agtttgaata cttgaaagcg gcaaccaaca ttttgctgca ttacaaactg       360
     caagataact ggcgtgtgtt gggcgggact tcgttgacct atcaaaccta caaacgctat       420
     ggcctgaaaa accacaatgg ttacgtcaat gatgtgtttc gcgaaggcaa tacgtgggaa       480
     gagaaatcga cggatatttt cctcgatgca ggcgtagcct acgattctgg ccacctgtat       540
     ggggagagcg attggcgtgt tagtggccgt tggatcttcg gtgtgccgat ttggagtgtc       600
     actgaaaact cacgttttga agacattcaa tttaacgact tcggttttag aaccaatgcg       660
     gaagcaaccc ttagctatca gatcatgcca ggtttgcatt tggggtggtt tgtgatgctc       720
     ggttacgaga aacgcttcga gtctgatccg caacgagtga tgtataccac agcaagtggt       780
     gtggagaagc aaggtcaagc ttggttgcca gaagcacaaa cttggacact caacacggga       840
     ttgcaagcgt tgtggaactt ctaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page