(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0054

BA000037.VV0054      Location/Qualifiers
FT   CDS_pept        complement(64970..66304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92818"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92818"
FT                   /db_xref="GOA:Q7MQF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF4"
FT                   /protein_id="BAC92818.1"
FT                   /translation="MQLGTSTTQVFYRLLDLNEEEKQQALQQLEQDAPEVYRALTPLMQ
FT                   PQESEPLTELLGFHAHHATDTSLDLAGQLIDKYQLTHELGRGGMGVVYAAYRADETFEQ
FT                   QLAIKFIQPSLTKVLGKKALFDEAQLLARLNHPCIAKVFDGGVYQDSVYIVMEQVDGVT
FT                   LDTYLKHHTLDQTAKLTLFLQLCQAVEHAHHNQVLHADLKPENILIDHAQRPKLLDFNL
FT                   TQKVSDQAKQQGKTGLVAFSEHYASPEQKSGGYLTQQSDLYSLGKILQLLFPHMKKRSD
FT                   LCFIAEKATQAIAEQRYLSVSELRVDIENMLACRPISLKQHIPLYTTKRLIQRRPMPTF
FT                   LLTLLVMTGVMFTSTLINKNRQLEQEKLIAEEMMYEVTRLMFHTKGNQLAQMSVSSMLE
FT                   ITRRRILSNPDIPKHIKQKMLLAMITPTPEKQVVEVDCQPNCQHP"
     gtgcagctag gtaccagtac cacgcaagtg ttctatcgct tgctggatct caatgaagaa        60
     gaaaaacaac aagcgctcca acaactcgaa caagacgccc cggaagtcta tcgagcgtta       120
     acccctctca tgcaaccgca agagagcgag cctctcaccg agttactggg ttttcacgcc       180
     catcacgcca ccgatacctc gctcgatttg gccggccaac tgatcgacaa atatcagctc       240
     actcacgagc tcggccgagg tggcatgggg gtggtgtacg cggcctaccg cgctgacgaa       300
     acgtttgaac aacaactggc catcaagttt attcaaccct ctctgaccaa agtcctcggt       360
     aagaaagcac tgtttgatga agcacagtta ctggccaggc ttaatcaccc ctgtattgcc       420
     aaagtctttg atggcggggt ctaccaagat tcggtgtaca ttgtgatgga gcaagtcgac       480
     ggcgtaacac tcgacaccta cctcaaacac cacacgctgg atcaaacagc caagctcacc       540
     ctgtttctgc aactgtgcca agcggtcgag cacgcgcacc acaatcaggt cttacacgcg       600
     gatcttaagc cagaaaacat tctcatcgac cacgctcagc ggccaaagtt actcgatttt       660
     aacttaacgc aaaaagtcag tgaccaagca aagcaacaag gcaaaactgg cttggttgcg       720
     tttagcgaac attacgccag ccctgagcaa aaatcggggg gctatttaac tcagcaaagc       780
     gatctctact cgctcgggaa aatcctgcag ctgctgttcc cgcacatgaa aaagcgctcc       840
     gacctttgct ttattgccga gaaagccacc caagcgatcg cggagcagcg ctacttaagc       900
     gtgagcgaat tacgcgtcga tattgagaac atgctggcgt gccgtcctat ttccctcaaa       960
     cagcacattc cgctctacac cactaagcgc ttaatccaaa gaaggccaat gccgaccttc      1020
     ctgttgacgc ttttggtgat gacgggcgtg atgtttacca gcacgctgat caacaaaaac      1080
     cgtcagcttg aacaggaaaa gctcattgca gaagagatga tgtacgaagt gacgcgtttg      1140
     atgttccaca ccaaaggtaa tcagttagca caaatgtcgg tgagctcgat gctcgaaatc      1200
     acgcggcggc gaatcttatc caatcccgat attccaaagc acatcaaaca gaaaatgttg      1260
     ttggcgatga tcacccccac accagagaaa caagtggttg aggtggattg ccaacccaac      1320
     tgccagcacc cttga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page