(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0058

BA000037.VV0058      Location/Qualifiers
FT   CDS_pept        complement(69026..69286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92822"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92822"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF0"
FT                   /protein_id="BAC92822.1"
FT                   /translation="MFQRFTAQTGQQQLGTFLTNLKTRRIDTGQFRTNRLADIQGVVAH
FT                   NGQLLRHFNATLLRAQQGTDGDVIIGTKDPVHLWIRHQGTL"
     ttgttccaac gtttcaccgc gcaaacgggc cagcaacaac tcggcacttt tctcaccaat        60
     ttgaaaacgc ggcgtatcga cactggtcaa tttcggacga atcgtctggc cgatatccaa       120
     ggcgttgtag cccacaatgg ccagttgctt cggcacttca atgccacgct gctgcgcgca       180
     cagcaaggta ccgatggcga tgtcatcatt ggtacaaaag accccgtcca tctctggata       240
     cgtcaccaag gcacgctcta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page