(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0064

BA000037.VV0064      Location/Qualifiers
FT   CDS_pept        74819..75349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92828"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92828"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE4"
FT                   /protein_id="BAC92828.1"
FT                   /translation="MKLVFFLCGFALCFSQASFSKDNFLRNEYNLGEILDAIKFDANND
FT                   SIEDFILAANQITVENSDQTYVITSNLDEIQCKAHVNSDQKETKLLILHGQSREVHRLS
FT                   QAHLILPCVGDFHGVKYGMSFISQQALSKSLGYDLVSDPNQMLVVIPTEAGIDTYLYWT
FT                   GERYQLFYPPEEP"
     atgaagttag tattttttct gtgtggtttt gcattgtgtt ttagccaagc atctttttct        60
     aaagataact ttctgagaaa tgaatacaac ttgggtgaga tattagacgc aattaaattt       120
     gatgcaaata atgattcgat cgaggatttt attttagcag caaaccaaat cacggttgag       180
     aacagtgatc agacgtatgt cattacttca aatctagatg agatacaatg caaagctcat       240
     gttaactctg accaaaaaga aactaagttg ctgattttac atggccagtc aagagaagtg       300
     catcgtcttt cccaggctca tttgatcctg ccctgtgtgg gcgattttca tggcgtaaaa       360
     tatggcatgt catttatttc tcaacaggcg ttatcgaaaa gtttggggta tgatttggtt       420
     tctgacccca accagatgct cgtggtaata ccaacagaag ctggaatcga tacatactta       480
     tattggacag gggaacgcta tcagctcttt tatcccccag aagaacccta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page