(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0070

BA000037.VV0070      Location/Qualifiers
FT   CDS_pept        80872..84018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0070"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92834"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92834"
FT                   /db_xref="GOA:Q7MQD8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD8"
FT                   /protein_id="BAC92834.1"
FT                   /translation="MRFCFSMLIMLCSFWASAHEKNILVVHSYHQGFFWTDSFQLGLAQ
FT                   TLGERDIALRVLYLDTKRNQSASFLNQLYFLYKTKVEQERFDAIVVSDNVALQLMQRLA
FT                   EPLAGTPVIFGGINNYTPEMHAGLNATGVIEDIDLLSNVSLIERLQPQAQQIFVVTDHS
FT                   ITGVALRAQVDKFLSRYPEYQQKVQHLVPNTVAELIERVQTLDLDSAVLFWAYYRDADG
FT                   TLSDDDDWQELNRVSRAPIYMVHDLGLGHGAVGGVIQSGYKQGFATGEVLNQVLDSPAS
FT                   PLPKVKVVEPDIKLDYQAVARWKLGVEGEPASVLVNKPEPFSVRYAQEIRLYSAVFVML
FT                   VLVIVLLVYYLRRIQQSETLARESQSMLESIFDQSLQYIGILDRNGCLVSSNAQLQDLL
FT                   FFQGVPLDRPLWQHQHWEDASATRLADYFSATEAQLSTFEAEIWSRNLGAMMLEVSLKP
FT                   LHSVGEQRGQYLFEARDITSRKLMEEKLYKRESNLRNYYEQQPVMMVTLDKNNRIQQVN
FT                   RFAQQLLGYQPLEMLGHLLQEFYCDAQAMTPRQMLLQPTPALQGVWRREIEYRHQDGSA
FT                   VWIRENIRPLTESGQILIVGEDISHNKQLARQLEYQAKYDLLTDTFNRNQFDIELKRAL
FT                   REVESHRRVHAMLYIDLDQLKVLNDTAGHDAGDGAIQFCASMLEEVLPHTAILARLGGD
FT                   EFAVLLKDSNEHTAIGVAKTIIATLSSQPFIWEKVQINLTCSIGIRMIDHTAESPQMVH
FT                   AQADTACHAAKEQGRNRFKLFSLDSEELQRRQQEMESVNLVHDALANDRLELFAQRIIP
FT                   LSKECDKMHFEILTRIRDKQGEYLSPAIFMPASERYNIAHLIDEQVVTKTLDWLEAHPD
FT                   ALHQLGRCSINLSGHSMGNPEFMAFLLDRLTNSVIPCHKLCLEITETAAMKNVALAMDF
FT                   FAQVKALGCLIALDDFGSGLSSFGYLKQLPVDVVKIDGIFVQDMHRNESDHIMVRAINE
FT                   LAQQMGKQTVAEFVENSEIIALLTELGVDYAQGYVIGYPTPLAELVAQWQDEFTSRSGS
FT                   "
     gtgcgatttt gtttttccat gttgataatg ctatgcagct tttgggcaag tgcccatgag        60
     aaaaatattt tagtggtgca ctcttaccac caaggtttct tttggactga ctccttccaa       120
     cttggcctcg cacaaacact cggtgagcgc gacatcgctc tgcgtgtgct ttatctcgat       180
     accaaacgca accaaagcgc cagctttctc aatcagcttt actttctcta caaaaccaaa       240
     gtggaacaag aacgctttga tgcgattgtg gtgagcgata acgtagcact gcagttgatg       300
     cagcgtttgg cggagccact ggcgggcacg ccagtgattt ttggtggcat taataattac       360
     acgccagaaa tgcacgcggg tttgaatgcc actggcgtga ttgaagatat tgatttgctg       420
     tcgaacgtgt cgctgattga gcgtttgcag ccccaagcgc agcaaatttt tgtggtgacg       480
     gaccattcga tcacgggcgt cgcattgcgc gcgcaggtgg acaagttttt gtcccgctat       540
     cctgagtatc agcaaaaagt acaacattta gtgccgaata cggtggccga attgattgag       600
     agagtgcaaa cgctcgattt agacagcgca gtgctgtttt gggcttatta tcgcgatgcc       660
     gatggtacgt tgagtgatga tgacgattgg caggaactca accgcgtcag cagagcaccg       720
     atctacatgg tgcacgatct cggtcttggt catggcgcgg tcggcggtgt gattcaaagt       780
     ggttacaagc aaggttttgc cacgggtgaa gtgttgaacc aagtgctgga ctcacccgcc       840
     tcacctttac cgaaagtgaa ggtggtggag cctgacatca aactggatta tcaagccgtg       900
     gcgcgctgga agttaggggt ggaaggcgag ccagcctcgg tgttggtcaa taaacccgag       960
     ccattttcag tgcgttatgc gcaagagatc cgcctctaca gcgcggtatt tgtgatgttg      1020
     gtgctggtga ttgtgctgtt agtctattac ttgcgccgta ttcaacagag cgaaacgtta      1080
     gcgcgtgaaa gtcagtcgat gctcgagtca attttcgacc agagtttgca atacatcggt      1140
     attttagacc gcaacggctg cttggtttcc agcaatgcac aattgcaaga tctgctgttt      1200
     ttccaagggg ttccgctaga tcgcccttta tggcaacacc aacattggga agacgcatct      1260
     gccactcgtt tagccgacta tttttctgcg acggaagcgc aactgagcac ctttgaagcg      1320
     gagatttgga gtcgcaatct cggcgcgatg atgcttgaag tttcgctcaa accgctgcat      1380
     agcgtgggag agcagcgagg acaatacttg tttgaagcgc gagacatcac ctcacgaaag      1440
     ttaatggaag agaagctcta caaacgtgag tccaacttac gcaattacta tgagcagcag      1500
     ccggtgatga tggtgacgct ggataaaaac aatcgtattc agcaggtaaa ccgttttgct      1560
     cagcagctac tgggctatca acccttagaa atgctcggcc atctgctgca agaattctat      1620
     tgtgatgctc aagccatgac gccaaggcaa atgctgctgc aaccgacacc agcactgcaa      1680
     ggggtttggc gtcgagagat tgagtatcgt caccaagacg gcagcgcggt gtggatacgc      1740
     gaaaacattc gtccattgac cgagtccggg caaattttga tcgttggcga agacatctcc      1800
     cacaacaagc agctggctcg tcagttggaa taccaagcca aatacgattt gttgaccgat      1860
     acctttaatc ggaaccaatt tgatattgaa ctcaaacgcg cgctgcgcga ggtggaaagc      1920
     catcgccgtg tgcatgcgat gctctatatc gatttggatc agcttaaagt gctcaacgat      1980
     accgcagggc atgatgcggg ggatggggcc attcaatttt gcgccagcat gttggaagaa      2040
     gtgttgccgc ataccgcgat tttggcgcgc ttagggggcg atgaatttgc tgtcctactc      2100
     aaagacagta atgaacacac cgccatcggt gtggcgaaaa ccatcattgc cacattaagt      2160
     agccagcctt tcatctggga aaaagtgcag ataaacctaa cctgctcgat cggcattcgt      2220
     atgattgacc atacggccga atcgccacaa atggtgcatg cgcaggcaga cactgcctgt      2280
     cacgcggcca aagagcaggg gcgtaatcgc ttcaaattgt ttagcttgga cagcgaagag      2340
     ttacaacgcc gtcagcagga gatggagagt gttaacctag tccatgacgc acttgctaac      2400
     gaccgtctag aactctttgc tcaacgcatt attccactca gcaaagagtg cgacaaaatg      2460
     cactttgaga tcctaacgcg cattcgtgac aaacaggggg agtatctctc gcctgcgatc      2520
     tttatgccgg catccgagcg ctacaacatt gcccacctga ttgatgaaca agtagtcacc      2580
     aaaaccctcg actggcttga agcgcaccca gatgcgttgc accagctcgg tcgatgttcg      2640
     ataaaccttt cgggtcattc gatgggcaat ccagagttta tggcgttttt gctcgaccga      2700
     ttgaccaaca gcgtgattcc ttgccataaa ctctgtctgg aaatcaccga aaccgccgcg      2760
     atgaaaaacg tcgccttagc gatggacttc tttgctcaag tgaaagcact tggctgcttg      2820
     attgcgttgg atgattttgg ttcagggctg tcatcgtttg gctatctcaa gcaattgccc      2880
     gtcgatgtgg tgaaaatcga cggcattttt gtgcaagaca tgcatcgcaa tgagagcgat      2940
     cacatcatgg tgcgagccat caatgagctg gcacagcaaa tgggtaagca aaccgtggct      3000
     gagttcgttg aaaacagtga aattattgcg ttactgacag aactcggtgt ggattacgcc      3060
     caaggctacg tgattggtta tccaacgcca ttggcagagc tggtggcgca atggcaggac      3120
     gagtttacat cgcgaagtgg gtcttga                                          3147
//

If you have problems or comments...

PBIL Back to PBIL home page