(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0079

BA000037.VV0079      Location/Qualifiers
FT   CDS_pept        complement(90690..91901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0079"
FT                   /product="uncharacterized enzyme of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92843"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92843"
FT                   /db_xref="GOA:Q7MQC9"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC9"
FT                   /protein_id="BAC92843.1"
FT                   /translation="MTSKKNNEPNKPEETTSQPITSDASTPETSNTESTASVSADEPTV
FT                   TPTTPPPAAAAKKEDKKPSQKLSILAIIIALLGTGGVAFQLQQQNSQYQAQIAALQNQL
FT                   QQTQSAMSTELNQVKQETVAKATEVTHKAEVVLAQQQKSIESLQLAMADVKGRRPNDWL
FT                   LAEADYLVKLAGRKLFLEHDVVSATSLMESADQRIAALNDPSLVPLRKAMAKDITDLKT
FT                   IPLIDRDGLVLRLTALQQQVDQLPLANAILPEAKTVEKQQVSDDINNWQNNLMASLKAF
FT                   SENFITFRTRDGNVIPLLSPEQHFYLKENIKAKIETAIKAVYQEQGEVYTTSLTTAEAW
FT                   SQAFFNQDNNTVKEFTQSLKQLSEQKIQVQYPVKLQTQNQLADVIRERLRREVTSMTST
FT                   EAQQ"
     atgacaagta aaaaaaataa cgagccaaat aagcctgaag aaacaacttc tcaaccaata        60
     acctctgacg cctccacgcc agaaacatcg aacactgaat cgactgcgtc cgtttcagcc       120
     gatgaaccaa cggtgacacc aacaacaccg ccaccagcag ccgctgcaaa gaaagaagat       180
     aaaaaaccga gccaaaaact cagtatcctt gccatcatca ttgcgttgtt gggcactggc       240
     ggcgtggcgt tccagcttca acagcaaaac agccaatatc aggcacaaat cgctgcgctg       300
     caaaatcagt tgcaacaaac gcaaagcgcg atgagcactg agcttaacca agtgaagcaa       360
     gagaccgtcg ccaaagcgac cgaagtcact cacaaagcag aagtggtgct ggctcagcag       420
     cagaaaagca tcgaaagctt gcaacttgca atggcggacg taaaaggccg tcgcccgaac       480
     gattggttat tggcggaagc cgactacctc gtcaaactgg cgggccgaaa actgttcctt       540
     gagcatgacg tcgtgagcgc caccagcttg atggaaagtg ccgaccaacg catcgcagca       600
     ctcaacgatc caagcctcgt gcctctgcgc aaagcgatgg ccaaagacat taccgatctg       660
     aaaaccattc cgctgattga ccgcgatggc ttagtgctgc gtttgaccgc tctgcaacaa       720
     caggtcgacc aactgccatt ggcaaacgcc atactgccgg aagcgaaaac cgtcgagaaa       780
     caacaagtct ctgacgacat caacaactgg caaaacaact taatggcgtc actcaaagct       840
     ttctcagaga actttattac cttccgtact cgcgatggca acgtcattcc actcttgtcc       900
     ccagagcagc atttctatct gaaagagaac atcaaagcga aaatcgaaac cgccatcaaa       960
     gcggtctatc aagaacaagg ggaagtttac accacctcac tcaccaccgc agaagcgtgg      1020
     tcgcaagcgt tctttaatca agataacaac acggtgaaag agtttactca gtcgttgaaa      1080
     cagctcagcg agcaaaaaat tcaggtgcaa taccctgtaa aactgcaaac gcaaaatcaa      1140
     ttggcggatg taattcgtga acgtctacgc cgtgaagtca ctagcatgac cagcacggag      1200
     gcgcagcaat ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page